CAZyme Information: AMAG_10195-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_10195-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1094		117732.52	6.9251

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745345:966600-970445(-)

Full Sequence      

MTPVTAPPPLPPRAESPDELTDGAEPAATPPRILHILHTLSVQAMLIDARDVPRISDVPG
ATSSLRRALSARPTVTLPLPTPACVPDDPLTPVWSHAPAVIDHASFPRADMHNVVGTGTT
RHTPPPPLAPPVPADGADTASDMRPRWKLVPRPGHQALYSGIHSLAHAAPPTVPLANRSA
RDLPVSAAAAAAESDDVIAYPSVYVGAVGPAVDSTGHVIEGYAFTPADQAELASLLWRDH
SAVAVFLDEATATDHYEGYCKTVLWPLLHYSLWEGVATDGRQEQRHWEAYVRANLEYAQA
ALRTYLPGDLVFVHDYHLLLVPAQLRAMVLGRRPPPTPSVDSNASSTFMSMILRGWNGEG
LPTEPPVDDDSASMATSWETQDMSIGLFLHTPFPSSELFRCLPKRAALLEAILGASLIGF
NNYSFARHFVSCCTRVLGLESTPTGIEYHGRHVEIGIFPIGIDAAHSDARRRSPAVRAKT
AALRELYAGKRVIVSRNKSDQLQGVVHQLLAFAKLLQLYPQWQNKVILVQITQPAAGQKD
ANAKLEAKVSELVAQINGTYGTIEYSPVHHVHRTVEPDDFYALLSVADVGCITSIRDGYN
TVSHELIVCQQPPPTSSTSSTFDDADTDPSWAPAPLILSEFTGTAGSLSAALIVNPYDYL
GVAATLADALSMPRAERIQRHRQSMAMVTKYTSPKWARSFVRALEGSHARHLMSATHTTP
RLDVARCVAAFHAAPMRLILFDYDGTLTPIVRVPSAAEPSPELLQALTALCADRSNRVFI
ISGRDQATLDAWLGHIPGLGLCAEHGCYLRMPYDARGWLDLTEELGDAAVWKAEIKEIFQ
YYQERTPGSFIEEKKSSIVWHHRLADPQFGAFQAKECQNHLENAVLSKLPLEVMKGKKNL
EVRPLAINKGEIVHRLLATAAPRGARFTYVFCAGDDVTDETMFKRLRREFRHPAKSPSTT
NANNPNTTTSAGVSGAGSVPPSPVAAYHHPIVDTVGTTSCTGSLAGGDAGANAAARGSQQ
TAVWTVTIGPASKRTTAGWHLQSPHEVVQVMLAWTGLASVASVTAPSRGASVGAPSVAAS
AAGNGVEARRTASS

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	381	705	4.1e-113	0.6442105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	225	947	57	691	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.05e-163	173	705	3	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215556	PLN03064	1.17e-155	243	1068	165	934	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	2.53e-155	228	705	61	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	5.40e-141	243	958	82	732	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13004.1|GT20	2.32e-234	147	948	46	735
AJH76892.1|GT20	4.92e-222	147	1051	85	826
CDS06611.1|GT20	1.11e-219	147	946	145	832
CDS09548.1|GT20	7.26e-209	147	943	83	759
AGJ01155.1|GT20	2.79e-205	146	1051	5	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	3.45e-88	221	704	58	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.14e-86	221	704	50	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUT_A	1.55e-84	228	704	61	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	7.81e-84	228	704	61	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVM_A	1.57e-83	239	704	80	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	9.75e-152	259	951	163	775	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54K57|TPSA_DICDI	8.51e-148	228	924	71	681	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	3.03e-142	245	946	128	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|P31688|TPS2_YEAST	1.51e-130	256	946	147	792	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	1.27e-128	256	946	152	799	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AMAG_10195-t26_1-p1.