CAZyme Information: AMAG_09784-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_09784-t26_1-p1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		34366.82	7.1488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745348:733300-735035(+)

Full Sequence      

MSLIAPAPPRTTARIASLMTVVLALALLLAVTVPSPVLAGKCPKMNKQCPANVPFCNKYG
YCSTTLADGMPQEGCNAGGSYPGVCADRNGCKNFKVDFDSPSQCPPRSSFGGNPDAQPFY
DQFANVEVKDSNVVLHMKYNNQLKSGMISKIASARYFKYGNFSARIRIPNPGKGFAYSFI
WKTSVDRDDVGDEPYKNRHEVQTNWFAGGVVDYTKGTSWLFPDNATTTDYHVYTIVYEPE
RIVWVVDDIPIRTVQKAGTNATFPSSEGMLFASIWDSCLSAPGTQAWAGGPSEVVRRECD
DAGQGQGLHDAGTQIP

Enzyme Prediction     

No EC number prediction in AMAG_09784-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	126	290	3.6e-24	0.9482758620689655

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395585	Glyco_hydro_16	8.97e-26	125	276	5	151	Glycosyl hydrolases family 16.
185692	GH16_fungal_CRH1_transglycosylase	2.05e-24	110	291	3	182	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185683	Glyco_hydrolase_16	2.73e-13	97	284	2	193	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185685	GH16_XET	3.39e-13	145	276	38	171	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
185693	GH16_laminarinase_like	6.93e-12	97	262	4	192	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK37843.1|CBM18|GH16_19	1.94e-25	54	290	33	257
QSS61834.1|CBM18|GH16_19	7.56e-24	42	290	26	271
BCS29145.1|CBM18|GH16_19	1.23e-22	46	305	31	287
QSS56628.1|CBM18|GH16_19	1.23e-20	46	290	29	271
QSS71477.1|CBM18|GH16_19	1.69e-20	46	290	29	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UWC_A	1.93e-08	149	277	49	187	Crystal structure of Nasturtium xyloglucan hydrolase isoform NXG2 [Tropaeolum majus],2UWC_B Crystal structure of Nasturtium xyloglucan hydrolase isoform NXG2 [Tropaeolum majus]
2UWA_A	2.65e-08	149	277	52	190	Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus],2UWA_B Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus],2UWA_C Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus]
2UWB_A	8.26e-08	149	277	50	183	Crystal structure of the Nasturtium seedling mutant xyloglucanase isoform NXG1-delta-YNIIG [Tropaeolum majus],2UWB_B Crystal structure of the Nasturtium seedling mutant xyloglucanase isoform NXG1-delta-YNIIG [Tropaeolum majus]
2VH9_A	9.47e-08	149	277	73	206	CRYSTAL STRUCTURE OF NXG1-DELTAYNIIG IN COMPLEX WITH XLLG, A XYLOGLUCAN DERIVED OLIGOSACCHARIDE [Tropaeolum majus],2VH9_B CRYSTAL STRUCTURE OF NXG1-DELTAYNIIG IN COMPLEX WITH XLLG, A XYLOGLUCAN DERIVED OLIGOSACCHARIDE [Tropaeolum majus]
1UMZ_A	3.85e-07	157	277	57	182	Xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide XLLG. [Populus tremula],1UMZ_B Xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide XLLG. [Populus tremula],1UN1_A Xyloglucan endotransglycosylase native structure. [Populus tremula],1UN1_B Xyloglucan endotransglycosylase native structure. [Populus tremula]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	1.18e-18	23	303	8	287	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	1.14e-11	123	290	158	326	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q5AJC0|UTR2_CANAL	2.26e-11	46	290	32	276	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q75A41|CRR1_ASHGO	2.93e-11	123	290	166	334	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1
sp|Q8LF99|XTH6_ARATH	8.94e-11	152	277	70	201	Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana OX=3702 GN=XTH6 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000294	0.999684	CS pos: 39-40. Pr: 0.9716

TMHMM  Annotations     

Start	End
13	35