CAZyme Information: AMAG_09045-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_09045-t26_1-p1
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	GG745343|CGC2	36345.11	8.6615

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745343:798163-799298(+)

Full Sequence      

MQPSLFALFLLALVAGTVNAHMMMAFPEPRNSKFHPGPTGEIDWSYTSPLGAFPCKGYKP
QAAFRTFAPGETVKVRIEGGATHNGGHCQFALSYDSDQTFVVIDTVIRECLRPGTGPFTY
DVQIPATAPSGKATFAWTWINAVGNREYYMSCADVQISGANSAPFSGPELLVGNLPGSKF
SFPEFPGNSPDNREFFNQRRTITVRGNGSGPAPQPQPQPTSSTVAPTPTRKPGKPGKGDK
DPEPPKPTSQPPSKPTSQPPSKPTTVPTKPTSVPPTNPQPTAQPPKPQPQPGKCTTGEMK
CSADGKKISQCFNDQWFDMDVPPGTKCSTELTGSPLIVTL

Enzyme Prediction     

No EC number prediction in AMAG_09045-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	21	177	5.3e-42	0.8481675392670157

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
237864	PRK14950	0.002	220	276	377	431	DNA polymerase III subunits gamma and tau; Provisional
411607	Chlamy_inclu_1	0.008	220	310	19	109	inclusion-associated protein. Proteins of this family are inclusion-associated proteins in Chlamydia. It has been shown that protein CPj0783, which is identical to the HMM seed protein WP_010892266, was localized on Chlamydial inclusion. CPj0783 interacted with host Huntingtin-protein14, which may play an important role in disturbing the vesicle transport system to escape host lysosomal or autophagosomal degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK37848.1|AA11	2.94e-43	16	192	14	186
CCT62801.1|AA11	1.89e-39	14	191	12	205
QGI76481.1|AA11	2.59e-39	14	191	12	205
QGI90179.1|AA11	2.59e-39	14	191	12	205
QKD46981.1|AA11	2.78e-39	14	191	12	205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	4.52e-17	21	162	1	153	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

AMAG_09045-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999789	CS pos: 20-21. Pr: 0.9760

TMHMM  Annotations     

Start	End
5	27