CAZyme Information: AMAG_08841-t26_2-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_08841-t26_2-p1
• CAZy Family: GH38
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
900		98343.24	7.5712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745343:216890-220164(-)

Full Sequence      

MVTWPGRRISSVLFKRFSFTTFNTTMSPTAAAIAPTSAPDVTPTPRRVIHVLHMLPIVAV
RLDRVAASPAPSAPNSRRHSRAATASMNGSAPLASTAPTVEALTAALHHQHQRDATRLDG
LVVPDTQGKWGFAPRRGHGALYAGIQSLDGVDGMSCVYVGSLGQVVDVYGRPLVGETWTD
AEWRELMSMLWVERKCVPVDLDDATATAYYDGYCKADLWPILHYSLWDSATDGRQEKSHW
DAYCRANAAYASTAADYFRAGDLVCVHDYHLLLAPSHLRTALDESALIGFFLHTPFPSSE
VFRCLPSRAHLLHGVLGASLIGAQTYSYTRHLLSACTRILGLETTPTGIDLDDGRHVAVG
TFPIGIDVARALHQANDPVVRARAAALRDQYRGRKLIVGRDKLDQIRGVHQKLLAFAQFL
EMYPQWRDQVVLIQVTSPSAENGKGSTKGLEAKVSELVAQINGKYGSLEVMPVVHVHRSI
EQSELYALLSAADVGLITSVRDGFNTSSHHFIVAQHATQQAPLLLSEFTGTAGSLSSAML
VNPWDRAGVAAALHAALTLPDHDRAMRHAQMYAHVSRHTAQAWAGAFTKALATAASCNAM
AVPRKRTPLLPIPKCLAAYRSSKKRLFALDFDGTLSPIVARPEDAKPARAVLDALRALTA
DPRNHVYIISGRDQATLDEWLGQHVSNLGLSAEHGSFLKPPGADAWIDIGEMQDWAWKDE
VLRIFQFHTERTPGSMIELKKSSVCWHYRLADPAFGMFQAKECQNHLENAVLTKLPLDLL
RGKKVLEVRPSYVNKGEIVGRLLHSASRAQPFDYVLCAGDCETDMDMFRRLSREFAGKPG
AAFSVMIGPASKRTVADWHLPAPADLIGVLQTMGRMEEEEVDVDGVHEVLESGVAIAASS

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	135	592	2e-148	0.9221052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	193	873	70	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215556	PLN03064	8.59e-169	184	819	152	797	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	2.69e-163	122	592	11	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215555	PLN03063	1.07e-160	145	828	42	717	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	2.77e-159	128	592	20	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06611.1|GT20	1.16e-254	106	873	127	871
CDS13004.1|GT20	1.96e-244	130	873	46	775
AJH76892.1|GT20	1.04e-236	109	878	69	834
CDS07232.1|GT20	3.18e-225	117	873	81	824
CDS09548.1|GT20	5.83e-225	130	873	83	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	2.58e-99	169	591	57	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	9.08e-99	169	591	46	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	3.95e-98	115	591	18	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5DXF_A	1.98e-95	213	587	151	519	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUT_A	1.34e-88	169	591	50	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	1.39e-163	213	875	163	814	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	6.01e-156	213	876	150	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q54K57|TPSA_DICDI	1.90e-155	115	866	22	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	3.35e-152	209	831	138	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9P4D3|TPS2_ZYGRO	6.52e-152	212	876	154	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000007

TMHMM  Annotations     

There is no transmembrane helices in AMAG_08841-t26_2-p1.