CAZyme Information: AMAG_08063-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_08063-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		56178.18	8.9231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745341:268509-270110(-)

Full Sequence      

MSAAVLSPVPHTAPWFDAPLRPRSAPPAVASLLLRSSSRSRSRSRSRSRSPGALRRQASS
PSSPSSSSPCRLPWLLDPPCAPKLDDVKAPGATIAAKPLVARGHRRTRSDSDAASAWCAA
QIMAAAAALWPATAVLAPTAGSDTSAESKQQQGEEGTERQEAKQHEPRSSDQSRAGPDCA
SSHGSSGIPTDDTQAIASPVPEPALGIPLPVCSSPSTASSPSPAPSITSPTPVLATPPRP
RRGVTFPPHLGAVRFFQRHARPADVAASRWAAADEPVAPRSQYALAAPNWPASIPTAPLP
AAVLAPRGSGPNRCRRMVEYQAAPAPPVVAPVPWARVAVESVRLMVRIDGDHESARLVGT
VLVRNVAYTKDVVVRATTNTWATFTDQHAEYVGAHDAGWDRFRFVVDVSHDVEVRSAANV
QLCVRYTYDEPDTWDADLATVAATDVPTRTTTVWDNNGECNYELRVQRWPVPPVPSSDAV
QAPAPAPALDKSLAAIAVTNAWSAAMAAPSWNLRLASAVDRRGIGGVGVPLGC

Enzyme Prediction     

No EC number prediction in AMAG_08063-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	352	463	2e-20	0.8598130841121495

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	2.17e-18	336	465	6	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY48398.1|CBM21	1.71e-08	337	465	94	202
ADY48364.1|CBM21	1.77e-08	337	465	94	202
ADY48096.1|CBM21	1.81e-08	337	465	94	202
ADY42480.1|CBM21	1.81e-08	337	465	94	202
ADY46296.1|CBM21	3.65e-08	337	465	175	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	1.14e-07	347	437	30	128	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6DDQ5|PPR3C_XENLA	1.69e-06	359	485	152	252	Protein phosphatase 1 regulatory subunit 3C OS=Xenopus laevis OX=8355 GN=ppp1r3c PE=2 SV=1
sp|Q6IN01|PPR3B_RAT	2.75e-06	357	437	144	224	Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
sp|Q86XI6|PPR3B_HUMAN	2.77e-06	347	437	127	225	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
sp|Q5BL87|PP3BA_XENLA	3.58e-06	357	437	141	221	Protein phosphatase 1 regulatory subunit 3B-A OS=Xenopus laevis OX=8355 GN=ppp1r3b-a PE=2 SV=1
sp|Q28E28|PPR3B_XENTR	4.07e-06	357	437	162	242	Protein phosphatase 1 regulatory subunit 3B OS=Xenopus tropicalis OX=8364 GN=ppp1r3b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AMAG_08063-t26_1-p1.