CAZyme Information: AMAG_07755-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_07755-t26_1-p1
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1858	GG745340|CGC3	205783.41	6.8628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745340:732253-738062(+)

Full Sequence      

MGKAKTKKGAAPAVPDLVGMDQAAPLADALHTALANASASRGTTLGGYAVRPLTDETDPA
VDDAIDDLDAAIAATLYGGYNNSQLYTRLGTSALVAVAPPAMSTILAELTSEQMKDRWYK
QYKNLKAEPLPSAIAAGRAPHNAGSAASLTPHVFGLANSLYFHLRRSGVDQSVVLRGESG
SSKSLQAELLLQQLCAISGNSKRDEKVHRRVLAAQTVLAAFGAAKTATSNDASRFGAYYE
VQFSDRGKMVGLKLITYGLERDRVAKQRLGERNFHVFYYLLAAASPEQKQAFGLLGSQNG
QAGTVFPYLNYGALPTQGIDDAGRFEALQDAMRAVGISKRVQHYMFKLLAAILHLGNISF
ANDQFHEQDNCVVRNREALQFVADLLEVDARFLESALTSRTHLVGRDLVTALLTAEKAAE
NRDNLAKVLYNVLFMYLVEAINKKLCSDEDMANFIAILDFPGNVATKTSTGANGGSSAAK
NAAAEDHGAAGVAYAYCNERLDAFINKRLFEYGNAELRAEGMAAPDTKYKTPKDAQAALL
ARRDAEEALPGDFINLFRGGNGQAGSRAPLFQELFSESIINMEAFEKNQATVVRGQSLVR
RQPSMKRSRSTRSAAGRSGSDSTLAGGGGSTSLKRSGSTAISELGHLTAQMDALADALDN
TNLKVLYCVRPNDDHTTSFDLKKVRTQCTAMQLGTVLAHVVRRGGDYTVRYSFDAFAEKY
APMFEVPENFTARDKCLHVKEIKGMADNEMWVGSSLVVLRDDAWVHLENMLRKQEQDLKK
RSKRGGGSIPLAKDRPRFNAFAADARTEYSAENDSVYSDGDYTDDGFGTEYDGDSVYDDS
IAGGPAGSGTGEGGALTERQLKARTEATKGDPLLDMDNAQVEEYTLTPQRKRWIFVTWFL
TWWIPTPFLRWCGGMQRDDIRMAWREKCAIFILIMFMCAAQLFFIIGFGRLICPRQNILN
LNELYYKTGGGTENPEALVGIYGAIYDLNNFYDTAYHAKDIMGSYAGYDVTAGFPRTPAF
YCSYARNNAPNFPPMFTRQTVANGTFIQLRHQEFYERDMYGAQRKIDWKLRQNVKSLVGW
DPDDVEALSQKSLNPRLLIIVKDRVYDLQPYVNAAVGQSFLPPDIVEFIKQNRGTDLTSN
PSFMGVWRREPELRNCFNNLFVVGVVDYRKSGRCMFTNYILVAFSVLLALVIGAKFLAAL
QLGSAGTPEEHDKFVMLQVPCYTEGEESLRTTIDSLASMSYDDKRKLLFIICDGNIMGSG
NDRPTPRIVLDILGVDPTVDPEPLSFQSIGEGMKQHNMGKVYAGLYECSGHLVPYLVVVK
VGKPSESSKPGNRGKRDSQMILMRFLNKVYFDSPMSPLELEMYHQIKNVIGVNPAFYELM
LCVDSDTKVHQDSLTRLVSVMTHDTKVIGCCGETRLANEKDSWATMIQVYEYYISHHMAK
AFESLFGSVTCLPGCFSMYRLRSATKSRPLLVSNELIADYGDCNVDTLHKKNLLSLGEDR
YLTTLLLKHFPNMRTVFTADARCETDAPERWEVLLSQRRRWINSTIHNLVELLSISQLCG
FCCFSMRFVVLIDLVATFLQPAIVAYLGYLIYLVVVSITSHDQNAFPMISLILLGIIYGL
QAIIFLIKREWQHVGWMFIYILAIPIFSFFIPVYSFWKMDDFSWGNTRIVVGEAGKKQVM
VAGDEAQKFDLRIIPHKRWSEYEADLWDQEGDLYSPQHPEDDNRSVRSGYSASGMSRSRS
VASAAAAAAAAAAAAAADLKRSNSTATAGTNFSISQLYGAPGAPPVPALPAHLGFPTDDE
IYAEVQRMLATANLMTITKKQVRDELSALFNVDLTPRKDFINQCINEVLQQQTQNMHM

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	1193	1704	5.4e-236	0.9886148007590133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	0.0	1192	1705	4	527	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
276845	MYSc_Myo17	1.35e-144	83	769	17	647	class XVII myosin, motor domain. This fungal myosin which is also known as chitin synthase uses its motor domain to tether its vesicular cargo to peripheral actin. It works in opposition to dynein, contributing to the retention of Mcs1 vesicles at the site of cell growth and increasing vesicle fusion necessary for polarized growth. Class 17 myosins consist of a N-terminal myosin motor domain with Cyt-b5, chitin synthase 2, and a DEK_C domains at it C-terminus. The chitin synthase region contains several transmembrane domains by which myosin 17 is thought to bind secretory vesicles. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
214580	MYSc	9.47e-103	80	772	30	677	Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
276950	MYSc	4.51e-97	80	760	11	633	Myosin motor domain superfamily. Myosin motor domain. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
276829	MYSc_Myo1	6.58e-77	149	459	52	359	class I myosin, motor domain. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. There are 5 myosin subclasses with subclasses c/h, d/g, and a/b have an IQ domain and a TH1 domain. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06114.1|GT2	0.0	69	1850	22	1892
CDS08031.1|GT2	0.0	71	1706	24	1689
CCA72950.1|GT2	0.0	72	1849	21	1903
QRV98874.1|GT2	0.0	69	1845	26	1903
QRW25802.1|GT2	0.0	85	1833	35	1885

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1MMG_A	1.05e-52	149	520	151	497	X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain [Dictyostelium discoideum]
1LVK_A	1.05e-52	149	511	151	488	X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain [Dictyostelium discoideum]
1MMN_A	1.40e-52	149	520	151	497	X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain [Dictyostelium discoideum]
1MMD_A	1.87e-52	149	520	151	497	Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 [Dictyostelium discoideum],1MND_A Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Alf4 [Dictyostelium discoideum],1MNE_A Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mg-Pyrophosphate [Dictyostelium discoideum],1VOM_A Complex Between Dictyostelium Myosin And Mgadp And Vanadate At 1.9a Resolution [Dictyostelium discoideum]
3MYH_X	2.50e-52	149	520	151	497	Insights into the Importance of Hydrogen Bonding in the Gamma-Phosphate Binding Pocket of Myosin: Structural and Functional Studies of Ser236 [Dictyostelium discoideum],3MYK_X Insights into the Importance of Hydrogen Bonding in the Gamma-Phosphate Binding Pocket of Myosin: Structural and Functional Studies of Ser236 [Dictyostelium discoideum],3MYL_X Insights into the Importance of Hydrogen Bonding in the Gamma-Phosphate Binding Pocket of Myosin: Structural and Functional Studies of Ser236 [Dictyostelium discoideum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4P9K9|CHS8_USTMA	0.0	86	1709	35	1753	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|J9VNT4|CHS5_CRYNH	0.0	151	1849	96	1929	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|O13395|CHS6_USTMA	1.70e-281	881	1710	61	898	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VF17|CHS4_CRYNH	2.02e-271	858	1731	123	1018	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	2.01e-146	893	1703	83	951	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000001

TMHMM  Annotations     

Start	End
930	952
1178	1200
1549	1571
1578	1600
1605	1627
1634	1656