CAZyme Information: AMAG_07617-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_07617-t26_1-p1
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		57144.78	6.8503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745340:327917-329618(-)

Full Sequence      

MSKPGAHPESHGRFGGPSRVMFLLVVAMALFIAVGLHGKQGPASAKSPGAVTLDEVTTSA
GSLVAPSILDGKDATPAVPPPAPPAAAPAKDTGKDKGKGKGKVAPSSPAPNANAASGPDA
NEDQPASPLAGQFDPSAANPVEDDVANGDTPVAKDSAPPAPAQPAPPAPRYPPPAAERGP
LFANLPECTTCTLLVVVPTSYNDLENNYRATVRSTWGALLRSLQHKSPHIAAPANATAKL
LFFVGTKGLDAASAAKLRAEADEHKDLQLLDFEESYQGLSAKMVLIHEWIHDNRAAFPEL
RFVFKTDTDVWFNVPSLMQLVDKHRPTQTMIGFKYVNNVRLLKGKWANPEFSSPVYPQYM
AGAGYLLSPDIASWVATNARAGWLKPLPNEDAVLGIWLAGSPVEWIHSSKFKHFVDPRRP
GRITRLHPYLCNDDDILFHHLTDDGIRILHQSFQTCGSPCEATCAQLEREAKERKADDAE
RQRHDQIAHAGGNVAGGVVPGVNVAGGVIPGVNMDAPAPAAAAPVVRNPAGAAPALPEGM
P

Enzyme Prediction     

EC	2.4.1.149:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	209	404	1e-36	0.9635416666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	1.84e-18	209	407	3	194	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	2.98e-08	206	399	396	580	beta-1,3-galactosyltransferase; Provisional
178735	PLN03193	3.26e-07	209	406	155	348	beta-1,3-galactosyltransferase; Provisional
396409	TIL	0.005	450	472	4	26	Trypsin Inhibitor like cysteine rich domain. This family contains trypsin inhibitors as well as a domain found in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9.
410995	TIL	0.009	450	469	4	23	trypsin inhibitor-like cysteine rich domain. TIL (trypsin inhibitor-like) cysteine rich domains are found in smapins (small serine proteinase inhibitor), or Ascaris trypsin inhibitor (ATI)-like proteins, whose members include anticoagulant proteins, elastase inhibitors, trypsin inhibitors, thrombin inhibitors, and chymotrypsin inhibitors. The TIL domain is also found in some large modular glycoproteins, including the von Willebrand factor (VWF), mucin-6, mucin-19, and SCO-spondin, among others. The TIL domain is characterized by the presence of five disulfide bonds (two of which are located on either side of the reactive site) in a single small protein domain of 61-62 residues. The cysteine residues that form the disulfide bonds are linked in the pattern: cysteines 1-7, 2-6, 3-5, 4-10 and 8-9. TILs can occur as a single domain or in multiple tandem arrangements. The disulfide bonds account for the unusual resistance to proteolysis and heat denaturation of these proteins. Smapins possess an unusual fold and, with the exception of the reactive site, shows no similarity to other serine protease inhibitors. The serine protease inhibitors comprise a large family of molecules involved in inflammatory responses, blood clotting, and complement activation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBN80895.1|GT31	1.40e-21	193	461	74	311
AWP03103.1|GT31	1.16e-20	193	461	74	311
SVE75278.1|GT31	1.56e-19	209	462	79	303
SVE74333.1|GT31	3.13e-18	209	462	79	303
CAJ84707.1|GT31	3.84e-18	193	460	51	290

PDB Hits     

AMAG_07617-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q502B3|B3GL2_DANRE	1.23e-17	257	460	303	488	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Danio rerio OX=7955 GN=b3galnt2 PE=2 SV=1
sp|Q9N294|B3GT5_PANPA	4.83e-16	182	398	44	250	Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan paniscus OX=9597 GN=B3GALT5 PE=3 SV=1
sp|Q5M900|B3GL2_XENTR	6.63e-16	255	460	296	483	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Xenopus tropicalis OX=8364 GN=b3galnt2 PE=2 SV=1
sp|Q9N295|B3GT5_PANTR	8.32e-16	182	398	44	250	Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan troglodytes OX=9598 GN=B3GALT5 PE=3 SV=1
sp|Q9Y2C3|B3GT5_HUMAN	9.86e-16	182	398	44	250	Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997938	0.002084

TMHMM  Annotations     

Start	End
20	37