CAZyme Information: AMAG_07615-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_07615-t26_1-p1
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522		59882.25	8.4610

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745340:319191-321084(-)

Full Sequence      

MGLTARTPSWRAVLSALIATAALIALIVRRHQLSSSWDEYDEEIADADDGDGPAPPRIQP
ILVWSPWYGRNDFWEGRRIDYCGVGQPACVVTHDRSKLAHSSVVMFHNADVNSYDLPPRE
KGKPWILFGRDAPMNNPWQTEPEHMRLFDLTMTHRTDSDFPIPWFDKSLVENALRPLDKA
RIFGKFNKWNDLPPIVWIEDDCTPPSQFPALVKELMKHVKIHSYGKCLNTLPSGRDLEQA
ESRTRLVEPYKFMLVTEYRNCAGFVQDKLMEAFRAGVVPIVDGPRNYSAIAPTPKAILHV
DDFKSIADLAAYVTRVSKDRAAYLAHLDYRIHRKTVPAAWRQYWSTTMEKGEWSGWCHVC
RFAVERQFEQYRAAFKDHASFVRAFRYRLSDQMTWYDADPRAPPSEHVIAFLDGIKPPPT
DVVDARSMGAVHAPFKVQWPDQTCVEGKWAALAAKQEIETKLAAVRRQARRKQLMQERAA
GQQQKQQARLKRLRDAGEVVDVAEDPRLLQQQHQQAPRHPLD

Enzyme Prediction     

No EC number prediction in AMAG_07615-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	53	370	1.2e-58	0.8818443804034583

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	1.22e-28	194	361	4	157	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
407214	Glyco_tran_10_N	6.09e-15	61	163	6	107	Fucosyltransferase, N-terminal. This is the N-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The N-terminal domain is the likely binding-region for the fucose-like substrate (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHH38960.1|GT10	1.98e-32	60	334	60	342
AAI57736.1|GT10	3.22e-32	44	330	110	407
AAI24381.1|GT10	5.51e-32	53	330	54	339
CAH04945.1|GT10	4.48e-31	44	353	97	413
AAI67262.1|GT10	4.48e-31	44	353	97	413

PDB Hits     

AMAG_07615-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q08C60|FUT11_DANRE	9.78e-33	53	330	54	339	Alpha-(1,3)-fucosyltransferase 11 OS=Danio rerio OX=7955 GN=fut11 PE=2 SV=1
sp|Q6A1G2|FUT11_XENTR	7.96e-32	44	353	97	413	Alpha-(1,3)-fucosyltransferase 11 OS=Xenopus tropicalis OX=8364 GN=fut11 PE=2 SV=1
sp|Q8AWC7|FUT11_CHICK	5.11e-31	60	353	88	385	Alpha-(1,3)-fucosyltransferase 11 OS=Gallus gallus OX=9031 GN=FUT11 PE=2 SV=1
sp|Q6A198|FUT10_BOVIN	2.39e-30	60	331	82	355	Alpha-(1,3)-fucosyltransferase 10 OS=Bos taurus OX=9913 GN=FUT10 PE=2 SV=1
sp|Q6P4F1|FUT10_HUMAN	3.29e-30	60	331	82	355	Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000003

TMHMM  Annotations     

Start	End
9	28