CAZyme Information: AMAG_06334-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_06334-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	GG745338|CGC3	51324.48	10.8340

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745338:486530-488302(+)

Full Sequence      

MDAARTALTRVAKEADRHPFTIMATLVALEVIFDYVLIARVPYTEIDWSTYMQQVDLVLA
GERDYSAISGDTGPLVYPAGHVWIYRSLHAATNGGTNRIVAQFLFTALHCLTLGVVMILY
RACQIPVVTFPLLCLSKRLHSIYVLRLFNDPFVTLFTMASLLALTRNRAWIASTLFSLGL
SVKMSALLVAPALLYQLAMRHGPLGFFAHVLLIVTIQFGAALPFLMHAPHAYLSRAFDMS
RVFMHKWTVNWRFVPESAFVSPSFALVLVSIWLALIVGMLVWWNARHQRGLPSALARWFV
RGKPGAPRNVWDGPRATVTLAFVVQLVGITTARSLHYQFYAWYAMSLPMLVQVTDWTWPT
RLAMLVAIEYCWNVFPSTSFSSGLLLVSHLALLVGVMRGHVFTAAAAPVHERRHSVRRRS
IQAAVYKATTTARDPAAAGPQRRMSIQKTVNVRQGSLAQ

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	24	382	1.1e-121	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	1.67e-164	26	382	3	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.
227937	COG5650	0.009	159	237	226	304	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV98819.1|GT58	1.37e-87	20	400	32	414
QRV84772.1|GT58	1.37e-87	20	400	32	414
QRW13371.1|GT58	4.28e-86	37	399	50	413
AEO36043.1|GT58	7.71e-85	20	398	52	422
QRW25746.1|GT58	1.94e-84	37	400	14	378

PDB Hits     

AMAG_06334-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7I4|ALG3_SCHPO	2.06e-82	18	382	26	384	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg3 PE=3 SV=1
sp|O82244|ALG3_ARATH	2.23e-80	10	396	17	415	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q9C1K8|ALG3_NEUCR	1.66e-77	37	397	51	411	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q55F69|ALG3_DICDI	5.16e-77	20	394	19	419	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|Q92685|ALG3_HUMAN	4.95e-75	17	399	40	423	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999861	0.000151

TMHMM  Annotations     

Start	End
142	164
169	191
204	226
263	285
339	359
374	396
20	42
99	121