CAZyme Information: AMAG_05132-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_05132-t26_1-p1
• CAZy Family: GH15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	GG745335|CGC2	39151.37	5.6772

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745335:45792-46874(+)

Full Sequence      

MQAQQVACDHAARIEELTLTVAKSRRRTRPTSTSIITETDAVDTTRSEAPAWSTSTSNRI
GLSRIPPLVHIMTKGVLDPQAAYCVDEWRRKNPGVSVLLWTDDDMDAMVSVHVPYLQPLF
RALPRGVLRADLFRYLVVATFGGVYADSDACPLKPLGQWLPTVSLRAEKGAGSTTAAADG
SSQTAAETPLIGNEDVALVIGMESDLATDDWYRFFARQLQLCQWTFAGVAGHPILTAIVA
ESVQRLRAKWAAGLGESGWPSITNEDVLDLTGPGVFTDVILAAWRTGKYQAGFEDLHYLT
EPRRFGDAILLPIVAFSPGQPQPGSDRPGIVGDRNSPGALIRHLFLGSWRAEGDALRNSQ

Enzyme Prediction     

No EC number prediction in AMAG_05132-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	83	161	4.7e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.64e-21	46	248	63	250	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.55e-15	83	161	6	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ01295.1|GT32	9.64e-47	88	360	145	392
AOW06798.1|GT32	9.64e-47	88	360	145	392
CAG77919.1|GT32|2.4.1.257	9.64e-47	88	360	145	392
CAD91643.1|GT32|2.4.1.257	9.64e-47	88	360	145	392
CAD24818.1|GT32|2.4.1.257	2.36e-40	65	350	142	394

PDB Hits     

AMAG_05132-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.19e-41	65	350	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.67e-34	88	353	127	379	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.61e-22	88	317	154	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.27e-20	92	354	129	474	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.10e-07	62	156	61	159	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999952	0.000065

TMHMM  Annotations     

There is no transmembrane helices in AMAG_05132-t26_1-p1.