CAZyme Information: AMAG_04432-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_04432-t26_1-p1
• CAZy Family: GH15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	GG745333|CGC1	69160.85	8.3377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745333:1635846-1637675(-)

Full Sequence      

MVLLTFNMWGQCMFALLVTGIGWTYLSWRTWQLYLVKSTNVIPYLFLSLEIMLYTSSVLW
FVDMLWTRDYRRRPAILPVENHAEWPTMDIFIPCCKEPTELVKDTVMAALWQDYPADKFM
VYVCDDGGDDALREWVENEQAVNGTNVRYIRRVKTPGVPHHAKAGNINHAMTVTTGEFVG
ILDADMLVRPEYLRRMLAQFSSPRVSFVQCPQAYYNVPDGDPLGQVCAFFYDVVMPHRDT
RNSAPSVGTGVVFRRKALEEVGGMSTGTLTEDFDTSIKLMGRGWHTVYINDKLQYGLVPT
DLRSALRQRERWAIGTLEILWKRNPLTAKGLSFHQRVMFFSCGLSYIIPVGIVIFAVLPV
LTLFWQFPIMPVMAGNTQTLVFLLVPYLFCTRLIIYVMYWNVPDAMTARNRDFQLFLWMA
PYLCVALGKFLMSGIKATSFKVTNAAPKKGKKRWCEFGELGSDLAKCSFHIAYCVLGLAA
LIYRGAHWNPTSCVDNFQFASQVLYVLLNVQSIAAPIVYVLSPDKGPADRRERLDYSKFG
VPIVDPVKVAPKPGKWVWLLEVVPVVWGAFYLILFIGFASGYSFGCDLYFAGSLPEISSD
DWSKATKLA

Enzyme Prediction     

No EC number prediction in AMAG_04432-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	89	314	1.7e-35	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	3.76e-96	86	320	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	3.35e-53	39	454	5	437	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.30e-51	21	348	201	526	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	6.80e-49	90	322	2	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
133059	CESA_CaSu_A2	1.36e-34	86	315	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PNR44324.1|GT2|2.4.1.-	2.28e-82	83	564	147	637
UKZ70923.1|GT2	1.20e-64	15	531	80	626
QYS95145.1|GT2	2.58e-64	15	534	145	693
UKZ70922.1|GT2	3.44e-64	15	531	146	692
UKZ45919.1|GT2	1.64e-63	15	534	61	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	8.64e-43	21	359	214	544	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	2.77e-38	44	365	86	424	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	3.78e-38	44	365	98	436	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	3.79e-38	44	365	99	437	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7CK3_A	1.95e-11	112	316	163	429	Chain A, Cellulose synthase A catalytic subunit 3 [UDP-forming],Cellulose synthase A catalytic subunit 3 [UDP-forming] [Arabidopsis thaliana],7CK3_B Chain B, Cellulose synthase A catalytic subunit 3 [UDP-forming],Cellulose synthase A catalytic subunit 3 [UDP-forming] [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WX61|BCSA3_KOMXY	1.28e-42	72	366	136	427	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	2.33e-42	71	364	132	422	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	2.33e-42	71	364	132	422	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|P37653|BCSA_ECOLI	4.27e-42	21	359	214	544	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q8X5L7|BCSA_ECO57	5.74e-42	21	359	214	544	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000000

TMHMM  Annotations     

Start	End
3	25
40	62
343	365
380	402
415	437
469	486
499	521
557	579