CAZyme Information: AMAG_03273-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_03273-t26_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1060	GG745331|CGC1	116372.75	7.2307

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745331:1920494-1923980(+)

Full Sequence      

MPAPRATPPHTNGATGARHKRSQSASDTRRIAALAAASPTKTGGSPTPAGRASPERVSRR
WVASTPSSDSPAPSTTLPPADDSVRGRTASADVTITATTTPTARLVHGTAPVRRDRHRRA
LSQSAVPAGRARSHTSDGRAGTPASTGARRRVRMRTAPHDVNGVNGRVTPLQAAAASLAP
PTHDDGDGGEDHGADVLTDTGSDDEYEDDDDTFSATSDEDQEFVPVSSFPAQDWMAGGGV
YVEGVHLRDAFGRTLQLRGVNLCGNSKMPITPHANNPEHPEFFDTKAVSFVNRPFPLADA
HEHFSRLSHWGLTFVRLLVPWEALEHGGPGVYDEAYISYLIELCELMPQYGIKCFIDPHQ
DVWSRFSGGSGAPGWTFEVAGLDIRKFKATGAAHVHNAHATGQCDCTVDPVSGVFTPKES
TEAPLAGQPPPMLWPTNYTKLASATMFTLFFAGATFAPKRMVNGENIQHFLQRHYCNAYK
YLASRLRHLDAVIGFEVMNEPHNGFIGLKDLKAYHPTETLVLGDSPSAFQSFCLGAGLEQ
EVEVWVRSWPIPSRKSSSRVLNTERERAWLPGYTCPWQDEGIYTVSTNGDTAKLAKPDYF
TTHPVTGKPIDFNQDCYLPFVTMYANSVQQGFPDSLVFVEPVPTELPPLFTHQVRHLIYA
PHWYDLKSLFFKSFNGVITHDVAALRRSRNLLAATYFGLAGAKRNYTGQLTTLKATGIER
VGHVPMIIGECGIPMDLNMRSAFATGDYAHHNNFLDAVLSAMEATLTHFTLWNYNPGNDH
AHGDFWNGEDFSIFSPHQHRQYNLKSEERRDKRKRSIQAMSAAGRRAPRALAPPPPRVRV
NGGAIVNSAPSVPTVVDDVEAMHGTDDEDDVAAPLLAALPKNSSTASSSTSLPPTPTTPF
DLTELVFNNDVKHHVGGRVLDAVIRPYAPRIAGTPTRMEFDLKTLAFHLEFVAHQVKLQR
DAMTAAYFKWLPSDLPAQCYETVIYVPNYHYAYETLVVDVSGGMWAYYKRHQTLVWRIFD
PTPGVTHWLRMGVKASGANKDRDTCAGKVKRVCGEWCVVQ

Enzyme Prediction     

EC	3.2.1.45:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	249	780	3.5e-190	0.9981447124304267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	3.29e-16	925	1030	1	85	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
223039	PHA03307	9.40e-06	2	160	142	305	transcriptional regulator ICP4; Provisional
237171	PRK12678	3.37e-04	31	167	52	192	transcription termination factor Rho; Provisional
237057	PRK12323	7.17e-04	2	179	428	621	DNA polymerase III subunit gamma/tau.
223021	PHA03247	0.003	2	144	2754	2890	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13578.1|GH5_12	9.27e-224	231	1021	18	698
EIE79467.1|GH5_12|3.2.1.45	5.18e-211	243	1023	18	662
QPC82820.1|GH5_12	1.41e-140	240	798	4	526
QRW15476.1|GH5_12	1.55e-139	231	795	22	578
QPC77175.1|GH5_12	2.88e-139	233	1014	11	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	6.74e-99	240	992	21	717	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
2OSW_A	1.92e-09	236	504	26	228	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	1.92e-09	236	504	26	228	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
2OSY_A	1.01e-08	236	504	26	228	Chain A, Endoglycoceramidase II [Rhodococcus sp.],2OSY_B Chain B, Endoglycoceramidase II [Rhodococcus sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1BTD7|EGCR1_RHIO9	9.20e-212	243	1023	18	662	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	2.65e-130	240	795	16	557	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	3.49e-117	242	795	8	563	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	4.06e-95	249	796	15	581	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000013

TMHMM  Annotations     

There is no transmembrane helices in AMAG_03273-t26_1-p1.