CAZyme Information: AMAG_02688-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_02688-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506	GG745331|CGC4	55828.46	11.3029

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745331:310900-312816(-)

Full Sequence      

MTIRRSSSCSSASSSASCRATLLPDDDAMSSTGRRPSLQTTSSSRSIMAATGDAFARVAK
AADRHPYTIMAGLVALEIIFDRALIARVPYTEIDWLTYMQQVGLVLAGERDYSAISGDTG
PLVYPAGHVWIYGALHGATNGGTNRILAQYLFAALHCLTLAVVMILYRVCQFPVITFPLL
CLSKRLHSIYVLRLFNDPFVTLFTMASLLALTRNRTWIASTLFSLGLSVKMNALLAAPAL
LYQLAMRHGPLAFFAHVLLIVTIQIGVALPFLAHAPRAYLSRAFDMSRVFMHKWTVNWRF
VPEPAFVSPAFALVLVSIWFALVVGMLVWWNARHQRGLPSALARWFVRGKPGAPRNVWDD
ARATVTLAFAVQLVGITTARSLHYQFYAWYAMALPMLVQVTDWTWPTRLAILAAIEYCWN
VFPSTNFSSALLLACHLALLVGVMRGHVFTAAAAPARGRRRSARRRSIQATVRKATTTAR
DPAAAGPQRRMSIQKTVNVRQGSPAQ

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	73	429	5e-122	0.989010989010989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	8.33e-155	73	429	3	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV98819.1|GT58	1.16e-89	67	447	32	414
QRV84772.1|GT58	1.16e-89	67	447	32	414
QRW13371.1|GT58	5.06e-88	76	446	38	413
QRW25746.1|GT58	2.50e-85	82	447	12	378
AEO36043.1|GT58	6.10e-84	67	445	52	422

PDB Hits     

AMAG_02688-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7I4|ALG3_SCHPO	2.87e-82	73	429	30	384	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg3 PE=3 SV=1
sp|Q9C1K8|ALG3_NEUCR	1.90e-79	84	446	51	421	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|O82244|ALG3_ARATH	1.69e-75	73	443	39	415	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q55F69|ALG3_DICDI	2.94e-75	67	441	19	419	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	9.95e-74	64	444	15	392	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000001

TMHMM  Annotations     

Start	End
147	169
189	211
251	273
310	332
386	405
427	449