CAZyme Information: AMAG_02187-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_02187-t26_1-p1
• CAZy Family: CE16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1317	GG745330|CGC3	142705.98	8.2873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745330:1017267-1021220(+)

Full Sequence      

MPRVRLHPCLRRALVPVLAALLGTVCGLILFRLYPEFCRQSLYNSRHVCSNNLVSVHGYV
ADLSRATSPRLQTVHAKYAGRDISPLVPRWLILAHRPEADTLVDGDLAECVSDTLVADAW
LALHLDRINNTNVIVGADGRLVKCAAPLPVNCTASNNTSSTATTSIPAPAPTNDKSKPTS
KTGDWDACINDATDLAELMSLVVGEALITSDVYQHPSTGTVERNGQIRKLDNLLHINGLV
LNVTTYLRHALLSRAQSTSANESLIRSGDTAYLPDPVNQWIMDVRTTKDRAMVDHAETLL
AERAKDQDQLDKWKRCLVKLFYVGKLSSVMYRQCWSRNWLLLVVLGGSALVFTVKVLFAA
ITVLRRSGPGHGVIRIVDVVFCCAWSRRRHGRLQKQKQARSAAHTSVDGGPAKLGKFSVT
VTADPSASPRTLPVTDASIGDDDEAHRAEHRRGPVLFLVPLFAEPVTVIQRTLSSIVQSE
ARHKALLVICDGNVQPVGEIKDTYRAVLDHLRYRPPPRLALAAAASGAPLALGHVDGASV
TFQYMSTGEGAKQWNVARLFSGYCTDENGATVPYVVLVKIGHPAERAAGTPLPGNRGKRD
SLLMALRFLQFAATRPAHCDATAAAAMTDFDGNDAGAPPAFSLAQAIYLAFAATGLDPRQ
IEFLCSVDGDTAVQRTAPRILTEYLTRNRDVAAACGSLIPDNAFTSLWSMCAAYRLYVTT
HLRLAWQQWTRLTILNPGFAMYRVQTVLPPPPVPDAVDTASTGGRRAGSPAESLRQIYNN
DAPNLDVIDLADADAPRAHSFDRRSLGSSINSVSPLRASGSSAAAISITTQSPLVVAHDL
VVARLGHPTLTTAFERNLYFLGEDLVLGTLLQLAHPQLRLAYVPRARAWTKVPTSLLHTF
QWLRRGWLAHVFVTLDALWAPIVPGARKKPCPIRQRMQRKRALGEEKAAAEAVAVDAMPP
TSSEEIEPLTVSERLVRFLSRTTSFFSLVMALLMPSIYAYGIVLIWSAIKWKPLFVLCSI
QAWGVAAGVHVLTLIVTGRWDVVAQLMAYLTAGLPLVLVASPVFAMFSVTRPRWSDQWCA
QGADVCMRVPGAMADASVDDVAVAMAISPPTSGTGKRMTMIVPAPVMTRRDSVSTFADTD
GGIDLAAAVSPPDLLASPAARALDTPPPSLPTDRAPLHAVAMPADFPAQWADEDLPETVL
GMRTSMFRTRAAAAVARVAGRLATHPQCVVLAAYAYWDEAAAAPADLINDDRVAAATRWF
VDEVTRQLAREVGDKVVLLDYLVEWEVRLYWAAHAETHSSLADEGPGGSQVECGRGA

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	452	746	6.3e-26	0.5009487666034156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	2.89e-28	455	908	27	371	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	3.12e-06	645	908	58	238	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	6.00e-05	662	772	80	179	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	0.005	859	929	235	307	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANG56506.1|GT2	6.59e-24	455	746	410	658
AAB84285.1|GT2|2.4.1.16	1.42e-23	455	746	409	657
SJX63286.1|GT2	1.50e-23	455	746	412	660
CBQ73450.1|GT2	1.50e-23	455	746	412	660
CDI53885.1|GT2	2.57e-23	455	746	411	659

PDB Hits     

AMAG_02187-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13395|CHS6_USTMA	2.66e-24	455	746	409	657	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|Q4P9K9|CHS8_USTMA	6.75e-21	445	746	1257	1515	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|J9VNT4|CHS5_CRYNH	2.24e-19	455	746	1255	1503	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|J9VF17|CHS4_CRYNH	4.32e-19	455	925	508	853	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	8.57e-16	455	908	460	795	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000017

TMHMM  Annotations     

Start	End
15	34
339	361
985	1007
1014	1036
1046	1068