CAZyme Information: AMAG_00150-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_00150-t26_1-p1
• CAZy Family: AA11
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1021		109254.59	6.3564

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745328:526129-529283(-)

Full Sequence      

MGIITVLRRLSLSSSARSSSGNSRRRRSSSGDPASRARARSPLSVSSSSPDVLASTDENT
GNSSSPRTPSSTMAPVPEVVANDGKNANESCPQPMDTPASPAPTPTPHAAPEATPATPAP
APKIETASPAVSAPAPTDAEPAVVAPTNGIAASPAVITKDLPAPATTTPPPVPPSTTMPT
ANTSELANGARLLVVSNRLPVTLAQDATTGSWTARMSSGGLVSALSGLKKDMAFTWIGWP
GKDFPADDQVRIADMLARVHRCVPVFLPDDIADAHYNGFSNSILWPLFHYHPGDMAFNEA
HWAAYHAANMAFADAIMATLQDGDIVWVHDYHLMLLPQMLRLQCDARGLRNVKIGFFLHT
PFPTSEVYRILPVRREMLLGLLQCDLVGFHTYDYARHFLSSCTQILGLATMPNGVDHEGR
FVHVGAFPIGIDPDQFVAALDTDAVRERVAHLRDRFAGTKVIVGVDRLDYIKGVPHKLHA
FKVFLDAHPEWMGKVVLIQVAVPSRSDVDEYQHLRATVNELVGRINGEYGTVEAMPIHYL
HQSVSFTELVALYAVADVCVVSSTRDGMNLVSYEYIAAQRDAHGVLIMSEFAGAAQSLNG
ALLVNPWNTEELADAYAAALAMPAADRANNHAKLFRYVAKHTAAYWGHTFVHELLRFTDA
NGPSAARHPAKLAPARFLANVAPPTAVNDRAPSPTASHFSTTTATNGGTDPLRSAVLRAF
FSAPQRVLFLDQGCTLASEHLRPEFSAPPPNVIAALRELAAVPNTAIYIVSGRARRHLAA
WYADVAVGLSAEHGCFYRHARDSHIESKSAETDADGWVALAHHVDLAWRDTVRPLFDHYT
ERTPGSYVEDKEVAFTWNYRDTDAEFGAWQANELQVNVEKMLSHLPVSIIPGGNKTLELR
PSAIDKASAVRAILADVGATPGAFVMSVGNGMSDEAVFACVANAAKDAVTVTVGKKSSAA
KYYVDGISDVHALLDALVVAAKDPALVANDDDDAPMCAAVVGKAGHDVPAVPELPALATA
E

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	181	654	3.5e-200	0.9873684210526316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215556	PLN03064	0.0	191	968	95	838	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
184712	PRK14501	0.0	190	978	1	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	0.0	191	981	12	787	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	0.0	191	654	2	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	0.0	188	654	13	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08550.1|GT20	1.12e-316	181	977	2	765
AJA04606.1|GT20	7.25e-231	189	989	127	888
AGT80036.1|GT20	7.25e-231	189	989	127	888
CDR39502.1|GT20	1.06e-222	188	656	2	469
AEO59700.1|GT20	2.52e-221	178	661	2	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	6.42e-218	188	672	10	492	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	2.77e-213	191	656	1	464	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	2.60e-212	191	656	12	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	5.00e-212	191	656	5	469	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.60e-210	191	656	5	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q07158|TPS1_KLULA	1.53e-221	192	661	18	487	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=TPS1 PE=1 SV=1
sp|P40387|TPS1_SCHPO	4.25e-220	183	674	12	497	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2
sp|Q54K57|TPSA_DICDI	6.06e-220	184	916	10	676	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q00764|TPS1_YEAST	7.13e-219	187	666	13	492	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS1 PE=1 SV=2
sp|Q00075|TPS1A_ASPNG	1.57e-218	178	659	1	480	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger OX=5061 GN=tpsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AMAG_00150-t26_1-p1.