CAZyme Information: ALNC14_139400:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_139400:RNA-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1027		116258.03	6.5630

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824670:2799-5948(+)

Full Sequence      

MYEDEDTDYALHGTPSATEAEIVRGGDQPRIAEGRPDAQQGYLDPRAPSEQPVSVLEAVG
MSIGEDQGNIISIHGYMHQQGKRSIIGPIQKKLEAAILWYALERAKIYYFQSHLECRQYF
GNRNADLVVGAIDLKDALQLRPCRRLDLPFKGIEIHTKRRVWVLCPETDEEYQMWFQGLE
RAIVANGSGNVIERKLPNVRKYQMKGNQTYRLFYFLYLLTGLLELFGLIFWFVVGLEPCD
SSRPSVDCDTIISTSLDTLRCTPDPMSGIWTPPDWYLSLAGVDDVSCFHDPPVLQWISFG
LMVAAELISFSLGCLYYLGMWSPVRRGAQYFDEFDPPVPDDVWPRVDVLICHYSEPSEEC
IDTLSACMNLQYPPHLLQIYLLDDGYCKAKWTKENPVPTIELNKGVLEAAGDLRQEVAQF
MYDRVCDPAEEMEVYAWRKLHSSANIPTPSRPKAVNRSDCAAGSFRDDYRYPGLPHVTFI
GRVKPDVHYSKAGNINNCLYNENASGRYLLILDADMQPHPKFIMAALAFFFVDEDRQDKS
LYTCCCTGCNHVASLCCASCKIAGVPEEQISFCSKECFENAMHVQGDLHRRQVNGSLSDT
RRIRKDLRCMTCDAKLGRSGICQKCKTNNVRETSVEVHHNYSDDVRDNAVAFVQTPQYFH
DCVQLQIGDPLGHRNATFYDAIQTGQDGYNCASFAGTNALFRREALDSIGGIQYGSLTED
CYTGQRLCSMGWKALYFRKDFEGQAQERIRLAEGLIPDSVASSLAQRKRWAKGNFQIFLM
RKNKKYIDPDWKPPVVTLPNHYKPNHFMRKVFYYNATLYPLGSFPAIFFYYITLYFLFSG
LAPIYMANLRLLVALVPKLFVQGVLSALSNRTVENNDVVRSQEVWFAYAFTMCTAVIEAI
WWRITGKEPRWFNTGGASRGSIAELPNVLVFLGTVVGVLWAIVRFMAGYNSSQTSHGASL
LFASLLMGIFLAYKLAPSVRMSIQEYFGWSYTSLTDKGNFMGSTSIAFGLIFIVLWVCIE
KPSSNPT

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	645	854	4.6e-18	0.8629441624365483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	6.27e-44	344	778	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	6.95e-19	646	837	366	535	cellulose synthase catalytic subunit; Provisional
224136	BcsA	1.44e-15	646	871	164	369	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	2.27e-14	647	780	111	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
404513	Glyco_trans_2_3	6.54e-13	645	781	23	149	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA27796.1|GT2	0.0	1	1027	1	1027
CCA26604.1|GT2	0.0	9	1027	5	1017
AEZ51038.1|GT2	0.0	8	1026	7	1024
ABP96903.1|GT2|2.4.1.12	0.0	8	1026	14	1025
UIZ24309.1|GT2	0.0	8	1026	5	1018

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	9.55e-16	645	781	252	382	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.04e-15	645	781	264	394	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.04e-15	645	781	265	395	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	1.16e-13	645	857	378	568	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	8.63e-27	475	778	584	765	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P19449|BCSA1_KOMXY	1.43e-16	645	778	254	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	1.43e-16	645	778	256	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	9.66e-16	645	778	254	381	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	3.74e-14	645	778	254	381	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000003

TMHMM  Annotations     

Start	End
212	234
296	318
812	834
849	871
884	906
921	943
956	973
1000	1019