CAZyme Information: ALNC14_135940:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_135940:RNA-p1
• CAZy Family: GT71
• CAZyme Description: DiNacetylchitobiase putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		40916.28	6.3375

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824567:8647-9991(+)

Full Sequence      

MALSSCPCLGEDLQATLPPCLPVNTEGRNRKEVFAFSPSKVDKWRHYDWDQVTTIAWDED
KRLVCHAHKKGVKIVVTLGFDNFDKICDHETRQVWIRRVYEKIVTNYADGFNFDIEKPSS
GAKSHCYVLLVKELRHVLKQSEYTKNAQITVDVPWAPHGIDGRYYDWNALAEAADFLFVM
SYDMRSQIYYQCIASANSPLALVRKGLEEYLLGYNIAPDKLVLGLPWYAYDYKCQNYSAA
LDICQIEQVPFAGAPCSDAAGKQRNYEVIRARAAADPAHYVRRWDNISHTPYYTYTNFEM
NETGQIWFEDPDSLSAKYALVREFGLRGGGMWHADGLSYGKDDESKKMWDSFKAMY

Enzyme Prediction     

EC	3.2.1.-:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	46	338	7.6e-42	0.8175675675675675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119354	GH18_chitobiase	1.63e-100	4	352	17	358	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
214753	Glyco_18	2.60e-32	66	336	61	333	Glyco_18 domain.
395573	Glyco_hydro_18	2.68e-27	47	336	43	306	Glycosyl hydrolases family 18.
119353	GH18_CFLE_spore_hydrolase	1.15e-24	60	332	47	300	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
226376	YaaH	3.66e-18	67	351	156	417	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA27450.1|GH18	4.63e-278	1	356	1	356
CCA16750.1|GH18	1.39e-277	1	356	30	385
UIZ27644.1|GH18	2.08e-126	3	351	464	832
AIG55971.1|GH18	3.41e-110	2	353	23	382
AFK11362.1|GH18	1.21e-74	4	351	22	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	6.20e-10	111	332	218	410	Chain A, Spore germination protein YaaH [Priestia megaterium QM B1551]
4WIW_A	2.07e-08	55	332	53	327	Chain A, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
4URI_A	6.28e-08	106	335	106	320	Crystal structure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia],4URI_B Crystal structure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia]
4S3J_A	1.85e-06	111	332	217	408	Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8R242|DIAC_MOUSE	5.52e-74	1	353	20	363	Di-N-acetylchitobiase OS=Mus musculus OX=10090 GN=Ctbs PE=1 SV=2
sp|Q01460|DIAC_RAT	1.41e-71	1	353	21	364	Di-N-acetylchitobiase OS=Rattus norvegicus OX=10116 GN=Ctbs PE=1 SV=1
sp|Q01459|DIAC_HUMAN	1.03e-69	4	353	39	379	Di-N-acetylchitobiase OS=Homo sapiens OX=9606 GN=CTBS PE=1 SV=1
sp|Q8T293|DIAC2_DICDI	7.89e-54	30	356	42	374	Probable di-N-acetylchitobiase 2 OS=Dictyostelium discoideum OX=44689 GN=ctbs2 PE=3 SV=1
sp|Q7KWW8|DIAC1_DICDI	5.59e-50	6	356	23	370	Probable di-N-acetylchitobiase 1 OS=Dictyostelium discoideum OX=44689 GN=ctbs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ALNC14_135940:RNA-p1.