CAZyme Information: ALNC14_126510:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_126510:RNA-p1
• CAZy Family: GT74|GT2
• CAZyme Description: 5'AMPactivated protein kinase subunit beta putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802		89469.39	6.7410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824424:10009-12982(-)

Full Sequence      

MTDNFVPQSVDYHIKCSNLASVDQSISISVFANEIETVQDDVMIKNLEDKVDQTKHKLFC
FLFNNEDADADCNKCLSHFSTSFGATTYYIAHTYVIFKLVVFPSTHEIKDVGSACVPIYC
TVLDAISEDACVKLDTIFGNDGKLLQRVEQAMKTCNMNVKRELPTPMVYPNLNLSPGKNA
VQNENCAKTGYLILDSVGPFLECRDHQCLHIAVTLSTSRQCIHCVSTRIKSPVLLASLSA
SKVTLLTQAFDVEKIRQACNVRGHCGTIALENLGFCSRYRTSNAIKPRIYPELGKMKRPA
FSSPTCLLAHAAFFRTPRTCKNCMQNHFQKDSKLHEYRTSPRTWLLWIRQLGGTASQLVD
QAIRDCQSKRSCLKVEQLEETVCIAHEMYMEPTGRKDVANVKVEFQSNRITGNLWPPTHP
VVEELYNFDKRSILLVGFAAKYAVDCLHCLMVRSEVFFLYAPTIDSNTGKAKNSGMGSTS
SKDHDAHPCELGTNATATPSTQIAQYSVKQSTQHPAPNASSLPPTSVPTSSDSTAPNSKI
TSQSLSSFKSTQSYSINANAPSKDAMEIDSVEPSTTQTNTLESTSSSVSSSTFVPEEDVV
PMVFRWEHGGRNVCITGTFNNWSKQMPMHRSGNDFVYITNLSRGKHAYKFVVDDEWRSAP
DQLTVADLDGNVNNYVDVSDFIPLSDIEALEKAQGEDSDKDENCMEQDARGTHREEFYGR
YIPDVDEYTKEPPPLPPHLRHIILNKAPPTIDSRLLPIPQHVALNHLYCTAIKDGMMILG
ITQRYKQKFVTTVYYSLMPGSN

Enzyme Prediction     

No EC number prediction in ALNC14_126510:RNA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	1.98e-39	600	682	1	85	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199889	E_set_AMPKbeta_like_N	3.75e-30	601	678	1	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
398422	AMPKBI	8.54e-26	738	796	9	68	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
214973	AMPKBI	2.37e-21	738	796	38	98	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
199892	E_set_Isoamylase_like_N	3.56e-05	607	676	10	83	N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins. E or "early" set domains are associated with the catalytic domain of isoamylase-like proteins at the N-terminal end. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA26507.1|CBM48	0.0	1	802	1	802
CCA27392.1|CBM48	6.55e-220	476	802	1	327
UIZ25814.1|CBM48	7.28e-108	589	802	113	312
AWP04182.1|CBM48	1.76e-41	601	795	76	264
AAH53787.1|CBM48	6.87e-41	601	795	77	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4REW_B	3.18e-41	601	795	3	194	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
5T5T_B	1.00e-40	601	795	13	201	AMPK bound to allosteric activator [Rattus norvegicus]
4QFG_B	1.00e-40	601	795	13	201	Structure of AMPK in complex with STAUROSPORINE inhibitor and in the absence of a synthetic activator [Rattus norvegicus],4QFR_B Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor [Rattus norvegicus],4QFS_B Structure of AMPK in complex with Br2-A769662core activator and STAUROSPORINE inhibitor [Rattus norvegicus],5KQ5_B AMPK bound to allosteric activator [Rattus norvegicus],5UFU_B Structure of AMPK bound to activator [Rattus norvegicus]
6E4T_B	1.37e-40	601	795	13	201	Structure of AMPK bound to activator [Rattus norvegicus],6E4U_B Structure of AMPK bound to activator [Rattus norvegicus],6E4W_B Structure of AMPK bound to activator [Rattus norvegicus]
4RER_B	1.52e-40	601	795	3	194	Crystal structure of the phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex bound to AMP and cyclodextrin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6PAM0|AAKB2_MOUSE	1.49e-40	595	795	71	268	5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1
sp|O43741|AAKB2_HUMAN	2.85e-40	595	795	72	269	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1
sp|Q5BIS9|AAKB1_BOVIN	6.88e-40	601	795	79	267	5'-AMP-activated protein kinase subunit beta-1 OS=Bos taurus OX=9913 GN=PRKAB1 PE=2 SV=3
sp|Q9QZH4|AAKB2_RAT	7.06e-40	595	795	71	268	5'-AMP-activated protein kinase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Prkab2 PE=1 SV=1
sp|P80386|AAKB1_RAT	9.39e-40	601	795	79	267	5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Prkab1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ALNC14_126510:RNA-p1.