CAZyme Information: ALNC14_108930:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_108930:RNA-p1
• CAZy Family: GT1|GT1
• CAZyme Description: betaglucan synthesisassociated protein putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		61751.62	7.1663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824301:28398-30074(+)

Full Sequence      

MLQTWNKFCFQGGMLEVRAQLPASMNEKSRNPDLARGPRASVKELEFYPAWPGIWMMGNL
GRAIFSASTQRMWPFSYNECNEKIFNSSNQRISACDSYPGSGLHPNQGRGAPEIDLIEGG
GSIVSASIQIAPGMPKQYRRIEPDPKLEDGGDTSCKYSATCATPGANQPNIPSQVYAQRK
HKSWYEGLRYSSNDFCTRNPKLKQDFRSIQNSLSHSITENNCSVMTCPASNDVQSDLGFI
DGDGRRGRWGINAKGTCFSAINAYDGTHLCDPDNQDLNCLNPRSASTAPTNSMPSFNYQM
DALSANWPIHVGGYTSYLTYQVEWVLGSNGYVRWMLENLPLFEIPASSVLNVPQDSVQSN
PKKIMPEEPMYLILNVAVSGSWGATPPNVGLPCRGNGRDEKVNRICDGFPMYLKVDYVRL
YQDVSNSSIMAVGCDPSTHPTKEWIQDHIEEYEDYDNKIVQVQGGATCRDTNDCTAKLKN
NLPVRTGTCTRGRCVCTCKYWGGPRCATAIDPALNSSTLTQTFGPSSPIALMVAMISVVA
TFLAFVNSLFDKRKSWKE

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	1	149	8.4e-44	0.4386503067484663

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	4.25e-45	1	455	186	479	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.48e-34	1	422	68	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	1.29e-10	319	421	162	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	7.00e-06	1	80	107	156	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185683	Glyco_hydrolase_16	3.15e-04	319	421	146	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA24749.1|GH16	0.0	1	558	1	558
UIZ28149.1|GH16	7.72e-228	1	558	148	707
UIZ28150.1|GH16	8.36e-224	1	548	87	641
UIZ28152.1|GH16	1.48e-216	1	555	137	695
UIZ27810.1|GH16	2.09e-216	1	547	184	733

PDB Hits     

ALNC14_108930:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	6.41e-21	1	453	395	688	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	8.74e-20	1	452	447	739	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87023|KRE6_CANAX	2.60e-19	1	453	420	718	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|P87024|SKN1_CANAX	1.01e-17	1	453	424	715	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|O13941|YEPB_SCHPO	1.08e-16	1	448	307	599	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000001

TMHMM  Annotations     

Start	End
528	550