CAZyme Information: ALNC14_100670:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_100670:RNA-p1
• CAZy Family: GH81
• CAZyme Description: 5A endo1 putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		58533.63	7.2625

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824258:30138-31917(+)

Full Sequence      

MASSTAGRPSISAARTSEVERIIATADVVSEFPGKAVKYRGRRSTWPGALGLLLFFAGSI
GGLTYFGIQKRNDVQHDTASDAAILDLYGSGDRIADGRMPQPDPDVAVLNPAEYQDLMCE
QPNYITKNNRIVAQFKSGREVIMNLKGVNWLGMQDNKYVPKGLWDGDKDGNTLTRYAAFL
SENGFNAVRLALSVDAALRNVVPDETLINTNSNRALDTSRYIPLLSSIIQGLGVYHIGVV
LNFQVLSALVKETGLWEGPSIKLADIQKAISNLANELCNGKHYNVIGIDLKDSLSMATWG
DKSESDWAQAATTLGNHVIRECSRWLVFVQGIEGPSRRNAFVAEDGSEKLVRLKYFTGSD
LSGVATAPIELRRTNKLVYSPKYFTSSYQLLDFFFSGGTPEGGLLTDYVESSNATLKKNV
ELSMEYMFGSALASGSAVVLSSFGGLVGTLDRTKLKTSTRIIEILISKMQNRTGGLAGGF
WWQFNPDAVYPYRTPDLANGTKAGLLLDSWKVANMPVLRELEKMADVPNVNFVPCV

Enzyme Prediction     

No EC number prediction in ALNC14_100670:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	140	488	3.3e-140	0.997093023255814

CDD Domains     

ALNC14_100670:RNA-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA23923.1|GH5_20	0.0	1	536	1	536
UIZ25210.1|GH5_20	2.16e-187	7	535	11	540
ABC87090.1|GH5_20	1.57e-98	6	535	103	627
ABK59037.1|GH5_20	1.57e-98	6	535	103	627
ABG80555.1|GH5_20	8.79e-95	11	535	113	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHO_A	4.66e-19	137	526	55	410	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3QHM_A	8.30e-19	137	526	55	410	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3QHN_A	8.30e-19	137	526	55	410	Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_B Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_C Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3AXX_A	1.11e-18	137	526	55	410	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3VVG_A	1.44e-18	137	526	22	377	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

ALNC14_100670:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999975	0.000066

TMHMM  Annotations     

Start	End
46	68