CAZyme Information: ALNC14_099360:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_099360:RNA-p1
• CAZy Family: GT90
• CAZyme Description: transmembrane protein putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582		66712.63	6.9107

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824252:17642-19390(+)

Full Sequence      

MKPNALTCVAIVHVIASAVFLAYAQEVPEASGKSPQQLLEENKLLVLPNEGAFATIFYDY
GRDSDDLLLSVRVLMRSIKDSSTRYRKFVLVPEDGLRQKTEKLFRRDGDIEIIQVDIPNV
FRDTLLIDQRAHLMHMRNKLVIWDDPILNQMKRIVYLDPENLVIQNMDEVFDCHDFCAVD
NGQAVVYANSLLVISPDSLPVRNLYADVIDSFMISGRSYNYIGITQGFIPGLFEAFEGSQ
LFYGVKDQLANDENDVERMEEDVIDRDTQPLLYRLPFYYSINHMVYYERLNWDLYKCRPN
INVTIPADIEPHTDTPYQLLGDSGGIPGPLLSFKYGGLLVRPGFWLPYVYFSVFWHWQTH
RARLQENHFQEFATQFVSASIIFGLIWYFYVKVCLKVFTTSSELSSGKPKRKGSNVAATT
DLSNAWMIQIICRVSCNLLSFISIAPPVSSMSLVGIICLLAIFLVPSRMEPMYAFVFWLY
INTLLIVTALIVIHVANALRRPTQNSNATRTTSVFLWSAFWSSLKKIWLHTIFLLMLLFF
IKHAELVKNPVFRPVVLINLFATALGLQMRLLWKQIVQLSAS

Enzyme Prediction     

No EC number prediction in ALNC14_099360:RNA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	4.44e-16	52	229	2	163	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133064	GT8_GNT1	0.009	53	197	1	139	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA23792.1|GT8	0.0	1	582	1	582
UIZ28025.1|GT8	8.42e-156	58	572	2	505
CCA16211.1|GT8	4.04e-21	52	399	48	351
UIZ21271.1|GT8	7.32e-20	52	345	38	305
BBN07132.1|GT8	4.62e-16	50	307	50	275

PDB Hits     

ALNC14_099360:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4JMI5|GUX7_ARATH	2.91e-12	49	309	57	287	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8VZP6|GUX8_ARATH	3.46e-10	49	309	61	290	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|Q8GWB7|GUX6_ARATH	6.07e-09	52	242	32	200	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000407	0.999554	CS pos: 24-25. Pr: 0.9714

TMHMM  Annotations     

Start	End
5	24
372	391
441	463
476	498
519	541
551	573