CAZyme Information: ALNC14_090160:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_090160:RNA-p1
• CAZy Family: GH5
• CAZyme Description: cell 5A endo1 putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		68838.41	8.4391

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824216:29473-31393(+)

Full Sequence      

MHNKVLSIRNLTKAFSSDENDSNSKRPPIANYCHPVLSESADSRLSDATSCTLPRHQARS
TYAYAESNFGLTPIIETESVCPRTSSTRMLPAHFPSTPGTAGRDQLPIGLFVGKDCSPKE
SSRDFHGRLKRWPGILLLLFVTIVVIAGLVFGTSSHYWARQKQARFASYNMQLKRKIRDA
ISDVVFDVADDGQMGNPKRYPDQHCALPDYQSKRGYLVAVGPGGEETPLHIKGVNWSGME
TVVAIPLGMWENPQNGTTLYEIGAFLARNKFNAVRIPISIENILRNTPPVKGIINLSTNR
AVSIRNFISTLQSIIVGLGHHGLGVLISLHRLTNTQDTGNWYDATLGISQEVYLDAVNLI
SSSLCKDRFWNVMGLDLKNEPHKASWGTGSSDDFVIGAEKIAAVMHRACPPWVGIVEGVA
GVHNLATRDTNVQYYDWWGGGLQKAKTIRPHFGIPNKLVWGPHYYTTAVAPQPYFYGPRY
ASEGICEELDNVTLKNNIGITMHDMFGYLVEERDSAVLLGEFGGLYTLDAHPMKTIQRTV
EYTIQIMKQKGYAGGFMWSLNPENAYEFNSCNGKGHFVEGLLKNDWLTPNTKSLAALSAM
DSMSYLKRFPCYKASPFDTK

Enzyme Prediction     

No EC number prediction in ALNC14_090160:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	227	563	3.9e-128	0.9912790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.36e-19	224	569	40	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.11e-08	248	564	17	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA22873.1|GH5_20	0.0	1	620	1	620
CCA19623.1|GH5_20	0.0	1	620	1	620
ABC87089.1|GH5_20	1.34e-198	112	613	70	573
ABK59036.1|GH5_20	1.34e-198	112	613	70	573
ABJ55765.1|GH5_20	4.31e-195	110	612	68	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	3.94e-41	210	588	7	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	5.41e-41	210	588	7	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	2.62e-40	210	588	40	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	2.62e-40	210	588	40	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	9.21e-40	210	588	40	396	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	1.43e-26	228	591	61	382	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	5.08e-23	229	600	42	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P04956|GUNB_ACET2	2.89e-12	231	565	59	408	Endoglucanase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

Start	End
136	158