CAZyme Information: ALNC14_075200:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_075200:RNA-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		83204.82	5.6911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824165:57070-59337(+)

Full Sequence      

MPKTLHSLCILGSALAGYAHAGHMSSKVDDIFDKLTLEGGLGQLFQLEAASTILNGSSLK
EDDLSKYATLGIGSYLNNIGIYDKNGTQENLNGSEIRAVIDRIMNVSLEKQPYNPILYGL
DSVHGANFVGKATIFPAQINIGATFDVKYAFQVEAIASDDTAGAGGKLIFGPVVDIPNNM
KGPRVQETYGEDTFLVSQMATQAVKGIQNSGLVAACPKHFLAYQATSIGYDRTNVEISQF
NLVNKILKPYMAATDAGALCIMESFSTLNTLPMVDNTYWLSYVLRDVLAFKGFVITDYKE
VQNLVDYHHTAENYSEALKRSIRAGVDITMTIDYYSDWIGMLKDIMKEDPSMIPFVTTAI
KRVIYVKSKLDLYKNPYSGKDLISKIGSQESIDMAVQVARDSIVLMRNNNNTLPLEKDMK
VFLSGNAFDSAGGQSGGWSRSWQGQDGNDFFKERITILDAMKKYAQKLTYTMGLNISEEY
NEQEVSKAKKMAMDADICVVALGEHSGVEKPYDIDDLAIPVNQTKYLNVMKAACKQLVLV
LVQARPRTFDDSSEIGAILNTALVGPFGGQAIAEILLGMYNPNGRQVLSYSMKDGYNGIH
YDSPVDTKCGNGECITEYPFGHGLSYSNFSYSNFKLSAENVSCTGKLTVTVDVTNNGPMD
GKEAVLLFIQQKTRSHVPEKKTLQAFQKITVRNGESMTVTFDLNQKAWTHLSPNIEDNFR
RVCEPGQFFVAMKYDTQCNFNGPEKGPMCGAFRIV

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	330	1.2e-54	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.90e-105	28	737	38	755	beta-glucosidase BglX.
224389	BglX	6.35e-53	35	439	1	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.24e-43	117	701	91	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.41e-43	36	364	1	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.18e-33	403	626	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA21377.1|GH3	0.0	1	755	1	755
CCA21376.1|GH3	0.0	1	755	1	755
CCA27737.1|GH3	1.64e-161	26	754	66	808
UIZ29009.1|GH3	1.30e-160	24	754	26	762
UIZ27116.1|GH3	9.88e-156	46	754	3	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	3.31e-104	24	703	13	714	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
6R5I_A	8.68e-82	95	736	57	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	4.48e-81	95	736	57	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	4.57e-81	95	736	58	723	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	8.39e-81	95	736	89	754	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	7.56e-110	28	730	80	809	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.35e-103	24	703	35	736	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.65e-85	95	736	88	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	1.19e-84	95	736	88	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	7.40e-69	106	732	63	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000424	0.999537	CS pos: 21-22. Pr: 0.9717

TMHMM  Annotations     

There is no transmembrane helices in ALNC14_075200:RNA-p1.