CAZyme Information: ALNC14_069730:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_069730:RNA-p1
• CAZy Family: GH37
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		43510.98	6.4845

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824149:62530-63777(+)

Full Sequence      

MATSNAIATHFIPKKLVWFRLTSIFIWSAVTINGHGYMGYLQESKYRELCVFYPGVDITG
YSALINGTRMCPGVQLGTDSPTNVKNFDGCMTKDYNYKSLVDFITENQEPLPNATPLYGF
SLPDKMEPVVLNKSLIFVQGIGHHGPCCIRCDDEIVSYKLNCALSYTTKPAYIPLDYEKC
VNAKMVWFYWVAMHGPSWQVYISAFPAVTGSMPAGAVEGANDSDAGPVGTAFSGGGSGNS
SASGSGTKGKTTGSPQGSNGYGDQTEAKGTPTAGQVTPAAGQPHGDGGKGNDATPTKESN
SNAYGAQSKTGNNDGAQKQDDPSKPSNPEAPGKPGGNGDAKNDDKKAENSTDGGYGDPSK
TNNNGGGQKESSPPKVETQATPKAAGSTNGNGDNGTDDNASKSAKCTLRKKDPNW

Enzyme Prediction     

No EC number prediction in ALNC14_069730:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	31	314	5.5e-44	0.9020408163265307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223003	PHA03169	0.002	218	382	83	246	hypothetical protein; Provisional
283060	Herpes_LMP1	0.003	273	393	231	356	Herpesvirus latent membrane protein 1 (LMP1). This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus. LMP1 of EBV is a 62-65 kDa plasma membrane protein possessing six membrane spanning regions, a short cytoplasmic N-terminus and a long cytoplasmic carboxy tail of 200 amino acids. EBV latent membrane protein 1 (LMP1) is essential for EBV-mediated transformation and has been associated with several cases of malignancies. EBV-like viruses in Cynomolgus monkeys (Macaca fascicularis) have been associated with high lymphoma rates in immunosuppressed monkeys
223079	PHA03419	0.005	320	395	77	152	E4 protein; Provisional
411053	dermokine	0.007	213	373	207	357	dermokine. Dermokine, also known as epidermis-specific secreted protein SK30/SK89, is a skin-specific glycoprotein that may play a regulatory role in the crosstalk between barrier dysfunction and inflammation, and therefore play a role in inflammatory diseases such as psoriasis. Dermokine is one of the most highly expressed proteins in differentiating keratinocytes, found mainly in the spinous and granular layers of the epidermis, but also in the epithelia of the small intestine, macrophages of the lung, and endothelial cells of the lung. Mouse dermokine has been reported to be encoded by 22 exons, and its expression leads to alpha, beta, and gamma transcripts.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA20830.1|AA17	4.08e-286	1	415	1	415
CCI46093.1|AA17	1.29e-52	70	211	1	142
EEY58936.1|AA17	1.03e-23	22	201	9	197
EGZ08731.1|AA17	1.43e-23	21	201	8	194
ETP39581.1|AA17	3.22e-22	32	203	22	199

PDB Hits     

ALNC14_069730:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

ALNC14_069730:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000062

TMHMM  Annotations     

Start	End
16	38