CAZyme Information: ALNC14_064230:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_064230:RNA-p1
• CAZy Family: GH3
• CAZyme Description: multicopper oxidase putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		53623.90	5.9168

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824135:34345-35784(+)

Full Sequence      

MESFSEAHRKWMGFPPSHNVPLSPIVLPSTISHPTFPGTYWWHSHEKAQYVDGLRGPLII
HDILQNVDGEYVLQLTDWYHTESRLLVANATNVTINPRGDKPVWNTVLINDRGRFNCTQL
DTTLFPVCNTTQPLSAIQFLPGKLYRLRLINQAGFASFNFSIDGHVFQVIETDGFPVQPS
KLINALVVNIGQRYDILVRANGSASDRFWIRSTSLFDSPFTSLPLDQFPSGFNPNGLAIL
EYCAEKRDSSMIEPKSTEWNFTITVANDLDFIPTDSIMLPRFPEERMTVEFTLAALQGDP
VTRGYASINQSPYETFLVPPTPTLFDVANGNLTFPSTLNPFVFVPQRHTEVVILNNSPAE
HPFHLHGHTPHVLGSGLIDINASNRSEPIPSSALNLLNPVRRDVFTLPSCTFNVTLGGCQ
DRGYVVLRLETDNPGTWILHCHIEWHLETGMAMLFIEDGPALMRRGTRGFGPSILETCA

Enzyme Prediction     

No EC number prediction in ALNC14_064230:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	37	452	1.6e-66	0.7597765363128491

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
259868	CuRO_2_LCC_like	6.85e-48	71	242	1	152	Cupredoxin domain 2 of laccase-like multicopper oxidases; including laccase, CueO, spore coat protein A, ascorbate oxidase and similar proteins. Laccase-like multicopper oxidases (MCOs) are able to couple oxidation of substrates with reduction of dioxygen to water. MCOs are capable of oxidizing a vast range of substrates, varying from aromatic compounds to inorganic compounds such as metals. Although the members of this family have diverse functions, majority of them have three cupredoxin domain repeats. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.
274555	ascorbase	1.77e-44	37	457	96	523	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	2.93e-40	37	457	118	546	L-ascorbate oxidase
215324	PLN02604	5.76e-40	37	457	119	546	oxidoreductase
225043	SufI	1.46e-35	37	452	125	443	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26495.1|AA1	1.03e-113	38	479	121	562
AFY09915.1|AA1	1.07e-110	38	475	119	561
AFY09916.1|AA1	1.02e-101	38	478	121	544
UIZ26488.1|AA1	7.92e-92	38	478	112	536
AIG55536.1|AA1	6.02e-75	38	478	136	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1V10_A	4.66e-54	38	460	125	492	Chain A, Laccase [Rigidoporus microporus]
3KW7_A	1.63e-46	38	460	104	475	Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2],3KW7_B Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2]
2QT6_A	2.86e-45	38	460	104	471	Chain A, Laccase [Lentinus tigrinus],2QT6_B Chain B, Laccase [Lentinus tigrinus]
1KYA_A	7.70e-45	38	460	104	472	Chain A, Laccase [Trametes versicolor],1KYA_B Chain B, Laccase [Trametes versicolor],1KYA_C Chain C, Laccase [Trametes versicolor],1KYA_D Chain D, Laccase [Trametes versicolor]
3X1B_A	1.10e-44	38	460	125	494	Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus],3X1B_B Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09920|FIO1_SCHPO	2.66e-53	38	457	124	497	Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fio1 PE=3 SV=1
sp|Q4PIF8|FER1_USTMA	5.32e-51	38	457	139	534	Iron multicopper oxidase fer1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=fer1 PE=2 SV=1
sp|Q12729|LAC1_PLEOS	1.04e-49	38	458	136	499	Laccase-1 OS=Pleurotus ostreatus OX=5322 GN=POX1 PE=2 SV=1
sp|E9R598|FETC_ASPFU	1.51e-49	38	457	119	492	Iron transport multicopper oxidase fetC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fetC PE=2 SV=1
sp|Q01679|LAC1_PHLRA	6.30e-49	38	460	125	493	Laccase OS=Phlebia radiata OX=5308 GN=LAC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ALNC14_064230:RNA-p1.