CAZyme Information: ALNC14_061840:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_061840:RNA-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		36116.06	6.1383

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824130:7831-8856(-)

Full Sequence      

MSLVHLISVQSHTFMSCPLATFTIASWPNPSGGFNTSILPENLREGFVFGDQDQNLINLQ
TAFKRYNSTRFYDFVSEFTIFDDAAYDKSCGTTVLDKPQPLPEYFKFSPIPHYGVCQIEC
NKTIVFESQNCQLAFGADWTTPITPEIRATCEHSVAIFSYIAPHGDPWQSYINCVNVGGN
DDPMPEKAKQECKPGGAKNGTVAPTTTPGQNGTPTPTPGQNGTPTPTPGQNGTSTPTPGV
PAPGYGTPNPTPGVHPTADGPPNSSPPPPPAANGTPLPAPVPTPTETNNPDNGNGSGGGK
DKKGDIYGTPKDGSKPAPGTSPYGTEQQGHSSKCTIRKIRR

Enzyme Prediction     

No EC number prediction in ALNC14_061840:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	6	237	3.4e-24	0.8734693877551021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
165527	PHA03269	4.14e-04	182	287	41	133	envelope glycoprotein C; Provisional
225689	DedD	5.56e-04	183	258	69	145	Cell division protein DedD (periplasmic protein involved in septation) [Cell cycle control, cell division, chromosome partitioning].
223021	PHA03247	7.72e-04	183	327	2799	2954	large tegument protein UL36; Provisional
411100	internalin_K	0.003	210	259	506	547	class 1 internalin InlK. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface-anchored proteins with an N-terminal signal peptide, leucine-rich repeats, and a C-terminal LPXTG processing and cell surface anchoring site. Members of this family are internalin K (InlK), a virulence factor. See articles PMID:17764999. for a general discussion of internalins, and PMID:21829365, PMID:22082958, and PMID:23958637 for more information about internalin K.
223021	PHA03247	0.005	182	333	2700	2841	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETI41716.1|AA17	5.75e-10	8	179	19	193
ETO70335.1|AA17	5.75e-10	8	179	19	193
EEY58932.1|AA17	4.20e-09	8	179	19	193
ETP36460.1|AA17	5.26e-09	90	207	92	211
ETI38512.1|AA17	7.10e-09	90	207	92	211

PDB Hits     

ALNC14_061840:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

ALNC14_061840:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000010

TMHMM  Annotations     

There is no transmembrane helices in ALNC14_061840:RNA-p1.