CAZyme Information: ALNC14_059470:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_059470:RNA-p1
• CAZy Family: GH18
• CAZyme Description: cell 5A endo1 putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		59674.75	6.6374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824124:42173-43989(-)

Full Sequence      

MSLMTEKNGIIRASCYDEDIHTALGTTTKYKGRIRTWPGLTLLVLLLGIASFFIPYGAYK
NRQARLEQARRAGRFKFNRHKIRGGVGLDVPDLVSDDGIIGNPKQYPATACQLPNYVSKN
GKLYAIADNGTEVPFKIKGINWFGMEQLNAIPFGLWQNADNGTTVYQIASFLSSYKFNSI
RLPLMIQHILMNQAPNPTLINRSENRAISIRSYFSLLKSIIKALQYREIAVVLSLHTLTV
ADTGGLWYNEHISYEDYLTAVDLLTSNLCSDDYWNVLGIDLKNEPYQATWGDKSDTDFVE
AAEKIGNRMLSGCPKWLAFVEGVFESREAIIDGKLMEYNDWYGGGLAGAEEVGVHLNQHQ
KLVWAPHYYSSSVYPQDYFYSHPNRDEATGLLDAYGELSNKTLRKRIEGTMESMFGFLAS
DHGPALLMGEFGGLYSRDQHPKKTAQRTIDIIIDIISSPNWAGGFVWSLNPESIFQYSRP
EEYGDFKEGLLKSDWLTADENYLQALRKMDSMQHLRKLPCFTDERSR

Enzyme Prediction     

No EC number prediction in ALNC14_059470:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	132	473	2.2e-163	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.94e-17	129	510	39	391	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.96e-09	167	433	28	238	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19804.1|GH5_20	0.0	1	527	1	527
CCA14407.1|GH5_20	1.23e-195	30	521	81	578
ABL75349.1|GH5_20	4.70e-191	12	526	116	633
ABG80555.1|GH5_20	5.48e-188	27	526	140	638
ABG80554.1|GH5_20	5.48e-188	27	526	140	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	4.16e-41	116	509	8	375	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	7.96e-41	116	509	8	375	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.04e-40	116	511	41	411	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.04e-40	116	511	41	411	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	3.75e-40	116	511	41	411	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19487|GUNA_XANCP	2.30e-29	118	509	27	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P54583|GUN1_ACIC1	3.69e-28	78	507	11	392	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	1.90e-25	108	497	30	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P10474|GUNB_CALSA	2.03e-19	134	433	644	937	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999927	0.000091

TMHMM  Annotations     

Start	End
37	59