CAZyme Information: ALNC14_055120:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_055120:RNA-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1020		115951.96	7.5949

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824114:77871-80933(-)

Full Sequence      

MDHDLNLNTPQSTSYRDANDMNAYNAHAAPRYEQEAVLMKQASTIDYDANSSAAITELTK
AEEHDMVGKISVHGWMHKQGTRKFKGPVAKSWRKRYFALEGTKIYYFHDQVDCRKYFSSR
NGELVVGAIDLRDAFKLEQSERLDLPARGIAIHTRHRVWLVCPETEMDFTMWFDALELTI
MTSGSGNVVKRELPNVRVYQMKGRSTYRIVYVFFVIAAILELASIVCWFPIGIAPCDLQM
KSDTCDDIQQTRTENLACMDEPFNGVWNPPDWYKVSAGVADVQCFVTPSIAHWLAFFLFT
LAETISIFLGSLYYLGMWNPVRRGAQYLRDFKPHFPPSKWPTVDILLCHYSEPAEDTIAT
LDKIMEVDYPSHLMHVWICDDGYCKAKWKNDPVPQVSVNRGVIENAGDVRREVAQFMYER
VCESDDIEVEEWRKQHTTVKMPTPSNPRVVSRIDCAVGSVRDDYNYQGFPKVTFVGRIKP
QVHHSKAGNINNVLYNEGASGRYCVILDNDMKPHEMFVQAVLPFFFDQPKNSKVMRCCAP
GCSDIGKICCSLCKNAGVPENHISYCSKDCFKASAHVKSSLHRRQTQNTVNERMVCSTCN
GKINKKLGTCKRCNAKQKRRMSSQLVDVGADDDYSDHVSVNQVGFVQTPQYFEDCLQIRL
GDPCGHRNATFFDSAQTGMDGYECASFAGTNAIFRREALDSVYGIQYGSLTEDAFTGKMM
LDKGWKGLYFRKDLEGEENERIRLAEGAVPETVSAALAQRKRWAKGNFQIFLRKKRSMID
PEWVPPQVELPPPRKINHFMRWVFFMNLTVYPIGSFPALFTFYVTTYFLYTGNAPVYMSG
LRLLIALIPKFLFQSVLSALSNRAVENNDVMRSQQTWYSYAFVHVLAVFEAIYWKITDKE
AAWANTGALAGNSIMELPNLLVFFSMVFGLLWAVVRFFCGYNNAATTHGTPLLFAAIYLG
VFTASQLGPMVRMSLQTYFGWSHKSLTDQGNIVASFSLVVMLIILCFWVFVETPDHSISG

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	634	838	3.5e-16	0.8781725888324873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.07e-36	341	771	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	9.76e-15	642	771	369	492	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	4.88e-14	642	773	113	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
224136	BcsA	1.27e-13	641	933	166	434	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	4.39e-11	633	843	18	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19369.1|GT2	0.0	1	1020	1	1020
AEZ51040.1|GT2	0.0	20	1020	33	1032
ABP96909.1|GT2	0.0	10	1020	13	1022
AXF53810.1|GT2	0.0	55	1020	54	1019
ABP96905.1|GT2|2.4.1.12	0.0	55	1020	54	1019

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.80e-10	642	771	382	505	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	4.86e-22	470	885	584	880	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	2.45e-11	638	771	256	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	2.45e-11	638	771	254	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|Q9WX61|BCSA3_KOMXY	5.52e-11	638	771	254	381	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P37653|BCSA_ECOLI	9.22e-10	642	771	382	505	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
210	232
293	315
803	825
840	862
875	897
917	939
952	974
989	1011