CAZyme Information: ALNC14_054990:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_054990:RNA-p1
• CAZy Family: GH18
• CAZyme Description: cellulose synthase 3 putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1714		191889.73	6.3642

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

Full Sequence      

MSAANLFAGVIDILCGLVACFASWSLLSSSSRSVHVCTQIISAFALGFTASYAAIVELSD
TNEWIALAAGGGCGIVLSVLIASLSFIGSFLILLATGCLLSTYLLYFDAHNGVHLFPADN
QLARQEFVIAFVIIFVLVFLSRSKTIQLECHRMKYLVFSSFVGSWCLTEGITRLIDDSAS
LAGVAFDSVQHGGLMASNHIDSSKLTLMFLLWIACFLFGMGHQLAMRWGLLCYNKIGTHA
KLGPLEETLPELPAGATLGAQIASDRVRLVCENCFATVPNGTVFCTECGEAMPSEEVDGN
VSISQAQMPSVSMNNQTNVPERWQQVAHRPYLSTTSFVDPKLAKGDSIKEGRSIRFIDNG
VQDADGKMRGYNDSMARPNTYYEPSFRSFAMSTYSMANRAAEPVETPNIRKYKMSGSGVF
HVVYFLSALTGLWWLYFLVGFYPQEYACSKEAPTLPCSKLPSSIREHCYPSTKNFDIVSQ
EGYCIQDTPSGIWIVFVMLAFSEFLNFFLGMLYNFSMWRPIRRGARFLNDFKPPLPREQW
PTVDVFLCHYMEPVVDSMRTLRNCLALQYPPELLHIFILDDGYTKSVWDANNHFKVTVNT
KVIEIAGDLRSEVARMMHERIIGPVEDDAVLKTWRRQHSSVRELKKDGGRGVQRRDCAVG
SLSDDYDYRDRGIPRVTFVGRMKPETHHSKAGNINNALFNEGADGKYILILDNDMKPHPK
FMQAVIPFFFSEGECLDGGGRQYSDDISWNQVAYVQTPQYFEDTPQLTLMGDPCGHKNTI
FFDAVQCGRDGFDSAAFAGTNAVFRRQAFDSIGGIQYGTQTEDAYTGNVMHKAGWDSVYF
RKDFEGDVKDRIRLCEGAVPETVAASMGQKKRWAKGAIQILLMRNVSEVDPDWRPPRVPA
PDPKPNLEFPRQMFFYDSVLYPFGSIPALCYVVIAIFYLCTGDAPIYAKGNKLLYSFLPV
MLARWMLNLLANRAVDNNDVWRAQQTWFSYSFITLLAISEAIQARITGKDKSWANTGAGQ
KTSWTEIPNVLMFFTIAVSEIVALVRFFQYESATSPWNYVSAMFFGFWVMGNLYPMVKMS
ITEYCGWDHTSATFTANVFGSLLLVFVVVFVQLWQFYYQSNLADCVRKNSRIRVWCLSGG
PVFLSKKDLDGRELMADEWKTKGNAALSAGNPKEAIEYYTKAIEINPSDHVFYSNRSAAY
LSLNDSENALRDAEECITRKSNWAKGYARKGAALHAQRKYNEAVAAFEKGLEFEPTNSAC
ITGKDEVVKAEAAAATNPFASAFGPDMFAKIATNPRISSYLSDPSFLQKMQEIQNDPSKI
NAHLQDPRVMNVFAELLGLSQGSSSHPSYTPTPTQSTPFQSNGNTTSAPTEPEPMEDDLT
EEELAAKQKSKKADEAKNKGNVFYKEKKFTEAIECYNEAIDIDSTNLSYYTNRAAVYLEL
MDFDACINDCKKAVEVGRENRADYALIAKAYVRIGNAHLKKGETDENLEAAIEAYECAQM
ENRTKEIDKKIKLLHQKLKKAKELAYIDVEKGLLAKNEGNEFFKGGDFPKAVERYSEAIR
RDPSNAVYYANRGAAYTKLTSFLEAKRDCEKAIELDPKYVKAYSRMGAIQFFMKEYHKAR
DTYVKGLEIDPNSQECKDGLQNVIMHINSGGSDAEREAHGLADPEIRSILSDPVMQNVLG
DFQSDPQSAQRHLQNPDIMAKIEKLMAAGVLRTK

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	814	1081	6.1e-19	0.36426592797783935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	8.31e-56	541	881	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	1.78e-32	493	885	231	496	cellulose synthase catalytic subunit; Provisional
224136	BcsA	2.37e-23	492	1035	9	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
276809	TPR	9.70e-23	1536	1628	5	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	3.21e-22	1156	1252	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19356.1|GT2	CCA19356.1|GT2	0.0	1	1714	1	1714
AFB77612.1|GT2	AFB77612.1|GT2	0.0	1	1123	1	1124
CCA23182.1|GT2	CCA23182.1|GT2	0.0	1	1123	1	1124
AEZ51039.1|GT2	AEZ51039.1|GT2	0.0	1	1122	3	1125
AFB20359.1|GT2	AFB20359.1|GT2	0.0	1	1123	1	1125

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KW7_E	7KW7_E	1.78e-90	1157	1711	5	540	Chain E, Stress-induced-phosphoprotein 1 [Homo sapiens]
3UQ3_A	3UQ3_A	4.48e-33	1393	1572	5	179	TPR2AB-domain:pHSP90-complex of yeast Sti1 [Saccharomyces cerevisiae S288C]
7LBY_A	7LBY_A	5.49e-27	528	968	258	577	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	5EJ1_A	5.40e-25	529	1012	116	499	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4HG6_A	6.51e-25	529	1012	128	511	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7ZWU1|STIP1_XENLA	sp|Q7ZWU1|STIP1_XENLA	1.87e-96	1156	1711	4	540	Stress-induced-phosphoprotein 1 OS=Xenopus laevis OX=8355 GN=stip1 PE=2 SV=1
sp|Q3ZBZ8|STIP1_BOVIN	sp|Q3ZBZ8|STIP1_BOVIN	2.29e-91	1157	1711	5	540	Stress-induced-phosphoprotein 1 OS=Bos taurus OX=9913 GN=STIP1 PE=2 SV=1
sp|Q60864|STIP1_MOUSE	sp|Q60864|STIP1_MOUSE	7.83e-91	1157	1711	5	540	Stress-induced-phosphoprotein 1 OS=Mus musculus OX=10090 GN=Stip1 PE=1 SV=1
sp|O35814|STIP1_RAT	sp|O35814|STIP1_RAT	1.45e-90	1157	1711	5	540	Stress-induced-phosphoprotein 1 OS=Rattus norvegicus OX=10116 GN=Stip1 PE=1 SV=1
sp|Q4R8N7|STIP1_MACFA	sp|Q4R8N7|STIP1_MACFA	6.73e-90	1157	1711	5	540	Stress-induced-phosphoprotein 1 OS=Macaca fascicularis OX=9541 GN=STIP1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000000

TMHMM  Annotations     

Start	End
5	27
34	56
66	88
90	107
122	141
153	175
209	231
418	440
491	513
919	938
953	975
1027	1049
1059	1081
1094	1116