CAZyme Information: ALNC14_052130:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_052130:RNA-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		29528.59	7.0092

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824107:93424-94257(+)

Full Sequence      

MHIVGSNLKITASPSAWFDALGSQYWDDLGYYGGHEKPMFAMIEVKYSTLIGLKVRNTPA
HAFMIACSEHSTFQNFKVDDSAGDLTPGRKAKNTDGIHILQSTAITVVGAEIINQDDCVC
ITSGFDVNITAITCLGGGLSVGSVGKNTNANEVTKVIFSQSTITNSLYGVLVKTWVGGHG
LVDQVTFEDISLKDIRMYGVAISQGYTNEGITAAPTDGVPITNLILRNVIGNVSPGAQRV
LVRCGSSKSCLRFFWTVVKFSGGEPSKGNLNVPDGAR

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	5	265	1.7e-52	0.7292307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.33e-51	3	276	48	319	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	3.06e-14	15	224	146	339	polygalacturonase
177865	PLN02218	6.23e-14	53	274	208	422	polygalacturonase ADPG
215426	PLN02793	6.25e-12	53	250	188	384	Probable polygalacturonase
215120	PLN02188	1.51e-11	63	250	179	364	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19070.1|GH28	3.34e-204	1	277	1	277
CCA19073.1|GH28	1.43e-98	1	276	1	273
AAA79885.1|GH28|3.2.1.15	1.29e-60	1	276	90	362
CAA71247.2|GH28	8.47e-60	3	275	96	367
CCA27288.1|GH28	2.68e-59	3	274	10	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IA5_A	1.96e-57	1	276	67	337	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
6KVE_A	3.15e-57	1	275	71	341	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	3.15e-57	1	275	71	341	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	3.59e-57	1	275	63	333	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	2.22e-55	5	276	67	334	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26215|PGLR_COCCA	2.30e-61	1	276	90	362	Polygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGN1 PE=3 SV=1
sp|O74213|PGLR1_ASPAC	2.76e-56	1	276	106	376	Endopolygalacturonase I OS=Aspergillus aculeatus OX=5053 GN=pgaI PE=1 SV=1
sp|A2QBB6|PGLRE_ASPNC	1.19e-54	1	274	106	374	Probable endopolygalacturonase E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaE PE=3 SV=1
sp|B8N8M2|PGLR1_ASPFN	1.28e-54	5	276	98	365	Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgaI PE=3 SV=1
sp|Q2UHL4|PGLR1_ASPOR	1.28e-54	5	276	98	365	Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgaI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000011

TMHMM  Annotations     

There is no transmembrane helices in ALNC14_052130:RNA-p1.