CAZyme Information: ALNC14_038900:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_038900:RNA-p1
• CAZy Family: GH131
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		44597.42	7.8978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824084:130687-131874(-)

Full Sequence      

MDTTNAQNGRSGISGAGPLPVQTPTLSPVNVVNDIIRGVVPMNGVTLPCLAIFEPWICQG
FASTKNLRAETLYNEVTFMASMETSAAIHLLSDLRDKWIAKQTIMDIKKLGLNAVKLKVG
YWLVEGSNSKFADAKKYVDNVMRWAEEYNIGVYLSLAAVPGCQNLQPVANCPNDKLDWTL
DGNIKRTVEIIKAIATEYKKFKSFLALSLIYEPTERGIDNRKLEYLYNTVIQDLQVQGFD
RLIMISPLLERRFNVDDAKFWCEFALARRNVAISISSYLYWDLLETEEKITTEVKKRGDF
LKANLKCPIVVDEWSMATRLDLTPEQRVTLAENQRMAYGAARNGSFYGPFQTSFLQDKYD
GFSYKSQVDFKIIKVDTTKGKLPPVTNDMNTMLAP

Enzyme Prediction     

No EC number prediction in ALNC14_038900:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	91	349	7.9e-24	0.9530685920577617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.06e-11	96	223	71	199	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA17747.1|GH5	2.90e-294	1	395	1	395
CCA20681.1|GH5	3.20e-92	15	374	37	412
CCA25979.1|GH5	1.97e-91	33	373	48	388
CCA23489.1|GH5	7.40e-21	34	353	41	377
AIG55998.1|GH5	6.68e-19	30	366	20	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	4.10e-10	33	238	11	217	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	5.48e-10	33	238	12	218	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	7.17e-10	33	238	6	212	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3N9K_A	7.28e-10	33	238	11	217	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
4M80_A	7.28e-10	33	238	11	217	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	1.26e-13	42	252	37	248	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	1.18e-12	19	325	22	338	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|Q0CR35|EXGA_ASPTN	1.66e-12	42	317	40	312	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
sp|Q12700|EXG_SCHOC	1.71e-12	42	250	42	257	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q12628|EXG_KLULA	7.36e-11	42	257	36	261	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ALNC14_038900:RNA-p1.