CAZyme Information: ALNC14_016160:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_016160:RNA-p1
• CAZy Family: AA2
• CAZyme Description: Rab1 family GTPase (PiYpt1) putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
953		105599.38	7.9518

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824057:23581-27029(-)

Full Sequence      

MLWVPCFLALVPCVLVLGQTPPIIVRGNKLFNSETKERFFIKGLTYEYAVSDTYYEQYSK
DVIRTKLQGLEFNAIRLYDVNPEQSYEKFMNDMAAMGVYVIVAASPDNNPYYGVYRYSTI
DKRLGPNNDDFSKTCYPALLLQYGKKVIANFAAYDNTLAILVANEIMQADLTAAACVKQY
VADLKSWMRVNGKKIRLIPLAYAAADSSYAGKIDNADIYHVLKIQGLLCGDQMVNGGMLK
SIDIYLINEYRWCPQSSYAESYERFLNMAKGLPITIAFGEYGCKLTKSTPRDWGMVPFMY
DAPSQTQGFSATFSGGLAYSFGLAKLSADSLFPMFTGGSSEITGVPSDVPTVDYANLKKS
FASHNSNKEVGSWSSDNICTWYPLTDAKIDPSNNRAISDGWIPPTCSSKNLVVASTDTWK
TPSREGVVCTDDGKTCDVILFKAFDTTQQSICGSYSVQNGGTLCNSSAACGTKGQCISSN
GIATCRCIACYTGTLCNIRDFSSCSSLSSFPAAPKYIFTIAAIFLVIMLAVFITLAIIAH
RKSIVINKLGKELQMRTKCGIQSKMPPKKKQEEAPRSYLGRPGNNVKIGIVGVPNVGKST
FFNCMSKLNIPAENFPFCTIEPNEAVVPVPDQRFHWLVEKYQPTSVVPPVMTITDIAGLV
RGASEGAGLGNAFLSHIQAVDAIYHMVRAFDSTEITHVEGNVDPVRDIQIIQDELRLKDI
ERVVKHVDGFRKGVERGLGGKEKKAELEAFLRIQEWLQEGKDVSFGNWSALEINLLNTMQ
LLTAKPVVFLVNVSKRDYLRKANKYLPKIAEYVNERGGGEQIIPLSCEFELELLDMDASG
QLAEYQKENPTHKSVINRILKMGYHALGLIHFFTAGKDEVRGWTIRKGRLAPQAAGVIHT
DFEKGFIMAEVQAFADLKEYGTEEAVKKAGKLKQQGKKYEVQDGDIIFFKFNN

Enzyme Prediction     

No EC number prediction in ALNC14_016160:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	19	324	6.1e-78	0.8878205128205128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
240334	PTZ00258	0.0	565	952	1	387	GTP-binding protein; Provisional
236583	PRK09601	7.87e-161	587	952	4	363	redox-regulated ATPase YchF.
223091	GTP1	1.82e-154	584	952	1	371	Ribosome-binding ATPase YchF, GTP1/OBG family [Translation, ribosomal structure and biogenesis].
206687	YchF	2.54e-129	588	867	1	274	YchF GTPase. YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1. Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome. Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins. Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor.
129200	TIGR00092	3.42e-100	584	952	1	367	GTP-binding protein YchF. This predicted GTP-binding protein is found in a single copy in every complete bacterial genome, and is found in Eukaryotes. A more distantly related protein, separated from this model, is found in the archaea. It is known to bind GTP and double-stranded nucleic acid. It is suggested to belong to a nucleoprotein complex and act as a translation factor. [Unknown function, General]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15473.1|GH72	0.0	1	953	1	953
UIZ26083.1|GH72	0.0	23	953	31	1000
CCA22645.1|GH72	4.72e-237	22	557	331	865
CCA14303.1|GH72	5.35e-172	23	454	60	500
AIG55862.1|GH72	4.03e-147	22	505	21	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EE0_A	8.40e-145	565	952	2	388	Crystal structure of OsYchF1 at pH 6.5 [Oryza sativa Japonica Group],5EE1_A Crystal structure of OsYchF1 at pH 7.85 [Oryza sativa Japonica Group],5EE3_A Complex Structure Of Osychf1 With Amp-pnp [Oryza sativa Japonica Group],5EE3_B Complex Structure Of Osychf1 With Amp-pnp [Oryza sativa Japonica Group],5EE9_A Complex structure of OSYCHF1 with GMP-PNP [Oryza sativa Japonica Group],5EE9_B Complex structure of OSYCHF1 with GMP-PNP [Oryza sativa Japonica Group]
2OHF_A	8.54e-130	565	952	1	388	Crystal structure of human OLA1 in complex with AMPPCP [Homo sapiens]
1NI3_A	8.10e-129	567	950	2	388	Structure of the Schizosaccharomyces pombe YchF GTPase [Schizosaccharomyces pombe]
1JAL_A	7.83e-87	587	952	4	362	Ychf Protein (Hi0393) [Haemophilus influenzae],1JAL_B Ychf Protein (Hi0393) [Haemophilus influenzae]
2DWQ_A	3.38e-76	588	952	4	367	Thermus thermophilus YchF GTP-binding protein [Thermus thermophilus HB8],2DWQ_B Thermus thermophilus YchF GTP-binding protein [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SA73|OLA1_ARATH	1.91e-145	565	952	1	387	Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=YchF1 PE=1 SV=1
sp|Q6Z1J6|OLA1_ORYSJ	4.17e-144	565	952	1	387	Obg-like ATPase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=YCHF1 PE=1 SV=1
sp|B8BBN7|OLA1_ORYSI	3.26e-143	565	952	1	387	Obg-like ATPase 1 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_28170 PE=3 SV=1
sp|Q8SWU7|OLA1_DROME	2.48e-136	565	952	1	386	Obg-like ATPase 1 OS=Drosophila melanogaster OX=7227 GN=CG1354 PE=1 SV=1
sp|Q7ZWM6|OLA1_XENLA	2.03e-134	565	952	1	388	Obg-like ATPase 1 OS=Xenopus laevis OX=8355 GN=ola1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999759	CS pos: 18-19. Pr: 0.9778

TMHMM  Annotations     

Start	End
516	538