CAZyme Information: ALNC14_014130:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_014130:RNA-p1
• CAZy Family: AA2
• CAZyme Description: dolichyl pyrophosphate Man9GlcNAc2 alpha1 putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		61156.86	8.4411

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824055:39826-41713(+)

Full Sequence      

MHEKEVSMRAEPQQFLLHFYEKSVSLCSLFLVINVIQRWLVSLGSYSGSSSPPMYGDYEA
QRHWMEITRNIPMAEWYYNSTNNDLMYWGLDYPPLTAFVSYAFGFVIQYLNSDMIALTSS
RGYETPTSKVIMRSSVILSDLLVLFPAVYLSVRVMYRSASRAQTYEKWRLKTLAPYLILS
QPAFILIDHGHFQYNNISLGLTAAAVALIYCDHDFLASVAYCLTLNFKQMTLYFAPAFGV
YLLSKCCYGDKCILHLMKLSVAVLITFGMLWLPFCIYRPLDSTCLSSWQQILHRIFPVAR
GLFEDKVSNVWCVLDLVYKARHHISRSKQLLLCTFTTLLALTPSMIDLLRRKPTKTRFSL
SLVNASLSFFLFSFQVHEKSILFPLLPVSLLVGKSPLIVGWFGLVATFSIYFLLAKDGQS
LQYFVLQIIHTLTALIPYNSGGFEISRCIVAPGHSAYGIPNHFLQTSVKVSLLGMVILHA
ISLLVPPPVRYPYIHECLFATFSCGCFLLALAYFTYWQWTLEDTEEKEESAIKKSI

Enzyme Prediction     

EC	2.4.1.267:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	35	514	1.6e-137	0.9937629937629938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	1.08e-140	52	509	9	471	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15270.1|GT57	0.0	1	536	1	536
UIZ20779.1|GT57	1.80e-169	4	534	5	588
AAH77552.1|GT57	5.69e-119	22	527	2	505
AAI33799.1|GT57	5.69e-119	22	527	2	505
AAH88570.1|GT57	1.60e-118	22	514	2	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SNH_X	1.47e-95	32	520	62	547	Cryo-EM structure of yeast ALG6 in complex with 6AG9 Fab and Dol25-P-Glc [Saccharomyces cerevisiae],6SNI_X Cryo-EM structure of nanodisc reconstituted yeast ALG6 in complex with 6AG9 Fab [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QG6|ALG6_DICDI	1.03e-116	19	514	10	503	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg6 PE=3 SV=1
sp|Q802T2|ALG6_CHICK	1.16e-115	25	514	5	489	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus OX=9031 GN=ALG6 PE=2 SV=1
sp|Q9Y672|ALG6_HUMAN	4.48e-109	26	514	6	489	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG6 PE=1 SV=2
sp|Q5NVS8|ALG6_PONAB	1.97e-107	26	514	6	489	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Pongo abelii OX=9601 GN=ALG6 PE=2 SV=1
sp|Q9FF17|ALG6_ARATH	2.61e-105	30	532	42	533	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=At5g38460 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000006

TMHMM  Annotations     

Start	End
88	110
130	152
215	237
252	274
358	377
397	414
421	443
463	485
498	520