CAZyme Information: ALNC14_013780:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_013780:RNA-p1
• CAZy Family: AA2
• CAZyme Description: alpha putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1222		137554.66	5.6481

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824054:196840-200508(-)

Full Sequence      

MTGALVENPIDTFAAKSMQRDENRCLSKDKEVALLRELSALYARLNQVREKRAKVEKETY
RSNSGGTGSRRKRRILLVTRSLPFKLISEDAQSQWRAEFPENITVDGATETYMCLHENYN
CIWIGSVHGEIEPSEQNTLREQLLQDRQYLPVFLDSKKERMFYHGFCKTVMWPILHSIPP
SDEDHLQHHEESGMTMDSYSSTVASSSNGLQSASASKNGATKSAKGTNGNSNINDDGTWV
GERSSLEKMWQAFVAVNQAFADAVQQVYEEGDLIWIQGYHLALLPQMIRNLFPNENVNIG
MFLHTPFPSSELYRIMNNREEILSGILEANLIGFQTYEYARHFQSSAVRLLGLESSHKGV
NFNGHFARVTICPVGIDAEKYITLVQSDAVQEQLKLAQDRFAGKKIILGVDQLDVSKGLI
HKLLAIEELFTLRPELAREVVFLQIVTGSNSSVESAMLLGAQVEALVSRINSKLQDVGAE
GPVQYLNQEISVEMLVALYCMANTLVVTPLRDGMNTVPFVYVACREGYGRHARVVLSEFA
GCAQSLSGAIFVNPWNTEELHDALLKSLQDNDEVMRAHQNMYSYISTFTSRHWADNYLEQ
LRECYEENALAASGRELSRRDMTSAYLRSHRRLIFINYEGVLASEASIPELAYPPQELIW
QLSMLTSDKRNTVVLVTSRSIAVCEQWFSTLSDNLVLAAEHGIYIKWCGKNEVWHCMVPN
MDMSWWEHVIPLLEYYTERTPGAYIERKDSSVTWHYRDCDLDHGLWQASELLVSLREITR
ALPVSVVPGNRCLELRPQKVSKASLFERIWDFMNHAAHHPEDAIARTDYFGEAVAPSTPV
LSRAIPRNASFPTTESFNDSIEDMSRVEREVKEHNRNSSRNRQEPVDFVLVIASGEDRMD
EDLFAVLVPPPIDLEAYCKQLEKEEMANSTGDVHAFTTADLNDNANKENRRNHIEASSGD
SACQNRYADSMRHNSENASSFFGTTAAESALKELSDSSSSQSMLSSDPNFLMLGENITTL
APLFTHSVVPKQSISDDAANMFPRTLLNSTTNARREEITEKSKFTPRRDFPPSAALFKAM
KTKYGENFGMHRLPTTAAACWALVCPPNARAKLEDTDSDLNSAHSEEVARHAGSSEGGEG
MHLSASPTAHTQSENEESRNHSNSHEDGRYRFPVNTFVCTLGRKLSQAPYYIKNSADLIQ
LLQEMGLNSHIRKQRMLAGDKE

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	69	602	5.6e-144	0.9789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	2.81e-166	74	812	2	673	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.07e-154	74	602	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	2.25e-145	122	601	47	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	4.85e-138	70	884	91	854	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
177855	PLN02205	1.44e-135	67	854	54	819	alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15235.1|GT20	0.0	1	1222	1	1222
UIZ28038.1|GT20	0.0	28	1218	8	1238
AJA04606.1|GT20	1.19e-154	64	809	119	806
AGT80036.1|GT20	1.19e-154	64	809	119	806
QOX06485.1|GT20	1.48e-151	13	814	1	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	1.50e-88	74	609	13	482	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	8.90e-88	74	601	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	3.27e-86	64	604	2	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	1.57e-85	74	610	5	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	2.16e-85	74	610	5	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	3.61e-133	74	809	17	673	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	2.91e-121	78	809	52	725	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q0WUI9|TPS8_ARATH	5.73e-120	62	821	50	772	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9ZV48|TPS11_ARATH	6.64e-120	58	809	37	757	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana OX=3702 GN=TPS11 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	1.43e-118	62	821	49	777	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ALNC14_013780:RNA-p1.