CAZyme Information: ALNC14_006910:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_006910:RNA-p1
• CAZy Family: AA2
• CAZyme Description: proline iminopeptidase putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
762		85695.91	7.0080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824049:185120-188007(+)

Full Sequence      

MGNAGSEIHEIDIVAPSVTTMLEINGLLSYAAFVVAALSISTSILLWVISPLIESKRLKE
APILVEEQSYEDPNQTTTEGNARIPFGSVLEENALLRLSVIIPAYNEESRITETLEDAIT
YLEERKEVSSSLTYEIIVVDDGSQDETARVVLAFVKKYTVRCIKLLCLKKNHGKGGAVRK
GILRSTGERILFTDADNATKIRELGKLEAILDDEHLSGKDGVIVCGSRAHLEKEAIAKRH
PLRNILMNGFHLLVSNLCVKQVRDTQCGFKLMDRTAAKLVFIPMHIERWGFDVEILYIAI
RHRLTIKEVAVEWREVPGSKLNVATASLSMLREILLIRLCYSIGLWNTDDNFSSVLLSYS
AQSNLLDMWRRCTILRKHPKASQRSRSAFQRSTSSSALKFPHASLNTEACGLLPIVAFSC
AVLSTGQSPESQSAHPHCAEEELYPVIKPHNTGYLSVSEGHQLYYEECGNPHGKPVLIVH
GGPGSGCRESMRCYHNPQKYRIILVDQRGSGRSKPRGSLHHNTTWHLVDDMEKLRQHLRV
DRWQVFGGSWGSTLSLAYAITHPGRVTELILRGIFTLRKKEIDFFYQSGANSVYPDRWEE
FVNIIPTEEREDLVLAYHKRLNSSDPNERIPAALAWTTWEKTTSNLCPPADAVEKSMNDS
EFAETFARIENHYFINEGFFPSDSFLIENVTKIRHIPTIIVQGRYDVVCPMQTAWDLHKA
FPEAELRVVQTAGHSALEPGIAKELVQATKKFESSRNSQLDH

Enzyme Prediction     

No EC number prediction in ALNC14_006910:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	99	272	5.2e-26	0.9411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
130316	pro_imino_pep_1	1.08e-159	447	752	1	305	proline iminopeptidase, Neisseria-type subfamily. This model represents one of two related families of proline iminopeptidase in the alpha/beta fold hydrolase family. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.
240336	PTZ00260	4.88e-105	21	351	6	326	dolichyl-phosphate beta-glucosyltransferase; Provisional
133031	DPG_synthase	1.39e-97	100	320	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
133022	DPM_DPG-synthase_like	2.23e-51	100	299	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
395444	Abhydrolase_1	2.32e-33	474	740	1	244	alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA14548.1|GT2	0.0	1	762	1	762
AHH37954.1|GT2	1.81e-76	85	349	54	317
AER94050.1|GT2	9.68e-76	97	350	66	319
AEQ00582.1|GT2	1.43e-74	97	346	44	293
AAG09682.1|GT2|2.4.1.117	1.45e-74	97	350	66	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AZW_A	1.25e-127	443	752	4	312	Proline Iminopeptidase From Xanthomonas Campestris Pv. Citri [Xanthomonas citri],1AZW_B Proline Iminopeptidase From Xanthomonas Campestris Pv. Citri [Xanthomonas citri]
1QTR_A	4.49e-116	443	752	7	314	Crystal Structure Analysis Of The Prolyl Aminopeptidase From Serratia Marcescens [Serratia marcescens],1WM1_A Crystal Structure of Prolyl Aminopeptidase, Complex with Pro-TBODA [Serratia marcescens],1X2B_A The crystal structure of prolyl aminopeptidase complexed with Sar-TBODA [Serratia marcescens],1X2E_A The crystal structure of prolyl aminopeptidase complexed with Ala-TBODA [Serratia marcescens]
5YHP_A	4.78e-107	443	752	40	351	Proline iminopeptidase from Psychrophilic yeast glaciozyma antarctica [Glaciozyma antarctica],5YHP_B Proline iminopeptidase from Psychrophilic yeast glaciozyma antarctica [Glaciozyma antarctica]
5EKP_A	5.36e-10	91	280	21	192	Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKE_A	5.36e-10	91	280	21	192	Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P93732|PIP_ARATH	4.17e-130	430	754	48	377	Proline iminopeptidase OS=Arabidopsis thaliana OX=3702 GN=PIP PE=2 SV=3
sp|O83041|PIP_LEPBY	4.74e-126	442	758	3	318	Probable proline iminopeptidase OS=Leptolyngbya boryana OX=1184 GN=pip PE=3 SV=1
sp|Q9PD69|PIP_XYLFA	1.59e-124	443	752	4	312	Proline iminopeptidase OS=Xylella fastidiosa (strain 9a5c) OX=160492 GN=pip PE=3 SV=1
sp|Q87DF8|PIP_XYLFT	6.28e-124	443	752	4	312	Proline iminopeptidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=pip PE=3 SV=1
sp|P52279|PIP_XANCI	4.33e-121	443	752	4	312	Proline iminopeptidase OS=Xanthomonas citri OX=346 GN=pip PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000089	0.000001

TMHMM  Annotations     

Start	End
27	49