CAZyme Information: ALNC14_006430:RNA-p1

Basic Information

• Species: Albugo laibachii
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo laibachii
• CAZyme ID: ALNC14_006430:RNA-p1
• CAZy Family: AA2
• CAZyme Description: UDPglucose:glycoprotein glucosyltransferase putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1677		189884.14	5.4500

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlaibachiiNc14	14629	890382	180	14449

• Gene Location: location=FR824049:74808-79947(+)

Full Sequence      

MTKVVTNKAPIRAVLMRLIVPLIPLFVAFLPQCDSRAIHVNVTASWRSAITYPLTEISEF
LAQEDPRLFWQWIDLLGAGDVFSTKMNDAADAETEVVLDVSGDAKSAVTAQSKSWSEMIE
NKHAMIERIVSKAMELTDTFLASHHSIIKLALLTRSYSPKVEMFRQMALDSVYHTSCDNR
ISAWAVVSNSKCVLAYACSIKELDALLQKSYEETSACIGPAENDRELPVDHVFVGSGDRD
TASQKLTIILYGAIATNSFFDLHETIKPFAKIGRFTYIVRHYNRDSSLPTLLQGYGVSLD
IKNMEYKTIDDDEHEKADDDHDDSELDNIDGISSDQKSALSEGLQQLEKESLQKQVDDTS
HDEEQSEEWNLNDLGMVATFEILQSKNPVRHIKSLSQDFPKHAKRLAMAKNLLPSDIRET
LRQWRISVVSYDYLDTLVVNGIPISATRGSFNAFDLLKLIQQEWSLVKKFSTLGLQEQDI
IQLRQIGVAPIAEARYGTEKVVRIMIRGPVDGITPIYLTNIETDPSLARLPKSINALKSP
SWHLIQIRRNMYEIGVIFDPTTQSGVEVLREMHFLYSRGAPIQFGILPTSKALLNTVDPQ
ERVELIRLWKRVTLGEQATSFHFSKIIFLIRGQALGDLADESLHSQFTKFLSLMLTLDVG
YTVSQLIGIYQKTIADMVETKDEVLAILKSDRLDEEVLSITEFISRKHLPFECHLFNGII
QPGLSLQENLMDNFGREQHVYQSLAREAKLSGKRDLIEQLLEHQDTYNSYFTIYSDSANK
VDFHSFVSESNAASSLLNNDLDETLERMLTDHVTYLHPIGSATVTKKETLVFHLSVFSPS
ACGHAYQGVAELLRTDSNHSSTARVGIVHLHENTPSNLEEDRKKVGQLILDVLSKANTTD
EKIMLEAIAHTFKCQMEYKSYEDTKQSLLGLLETFESNYATEWKELVKAHVSLPILKVDP
DKQRLSNLLAVSTGQCGNSAAGKLTLSTSHLFLNGRCVDLSDYILGEFDIKDLIAYDLET
RTEDAAKVVLKDDDSEMSVQDAGLKSLYLMKVCGLLDQYRHWDRYNALDLLTESGTKNRS
MIHIDGDSTLNVVAFLDPLTEATQRMSSILETLQTQLNATIDIILVPDSEYSEFPLRRFY
QYVFGNAPLHLGNSILNGAAFRSLPIKPILTMNIDTVEEWNVHTHESRYDADNLMVDPKN
EAEVRGTKTVSYILNNVLVYGRCVDVTDGRMIPPNGLQLILHQRFGNEKLSHDTLVMRNL
GYFQLQATPGIWSLHLARGRAANLYEIVMNHGDSSTETEVVYSIPVFISDFNTRKTNLVV
KKRVGKEQIALLDSDEHDDANYVDEETKEAGTPGSVLTSYWNSVSSLLTGRKSAISTSSD
EALKNSKETIHVFSLATGHLYERFLKIMMLSVVKRTKSDVVFWLLENFLSPNFKRSVPAL
QAEFGIEIRLITYKWPKWLRRQTVKQRIIWGYKILFLDVLFPLHINKIIYVDSDQVVRAD
LKELWEMDLKGAVYAYAPFCGSRNLGFQFWREGFWKSHLQGKPYHISALYLVDLKQFRKV
AAGDTLRGIYEQLSSDPNSLANLDQDLPNFVQHNIPIFTLPQEWLWCESWCSDETKAEAK
TIDLCNNPKEKEPKLEMAKRVISGDLFQESWIQLDQEIRESEKRYVAGLQSSDAGTI

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1390	1635	1.4e-120	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	2.99e-179	1390	1660	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	3.49e-154	1390	1635	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	1.65e-56	1390	1630	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	3.86e-32	54	282	5	177	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	6.33e-23	1221	1333	2	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA14500.1|GT24	0.0	1	1677	1	1677
UIZ20865.1|GT24	0.0	34	1667	24	1662
AIG56125.1|GT24	0.0	25	1669	15	1509
AIG55512.1|GT24	0.0	25	1665	13	1515
AAI25833.1|GT24	5.27e-182	34	1673	20	1513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	8.46e-142	225	1664	148	1450	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	8.46e-142	225	1664	148	1450	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	4.09e-141	225	1664	148	1450	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.02e-127	1088	1664	654	1216	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	2.81e-114	225	1597	141	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	2.90e-181	38	1660	33	1567	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q9NYU2|UGGG1_HUMAN	2.57e-171	32	1665	41	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9NYU1|UGGG2_HUMAN	3.15e-171	35	1660	32	1497	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q8T191|UGGG_DICDI	2.51e-169	34	1662	33	1637	Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum OX=44689 GN=ggtA PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	8.08e-169	16	1660	25	1522	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.383027	0.616959	CS pos: 35-36. Pr: 0.5135

TMHMM  Annotations     

Start	End
13	30