CAZyme Information: AKAW_11018-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_11018-t41_1-p1
• CAZy Family: GT48
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	DF126509|CGC1	85640.93	4.6443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126509:33388-36318(-)

Full Sequence      

MVAGLFAKALLLLQLGSGALAVQNVSRPLYKNPHAPVEARVSDLLSRMTVEDKMAQLMQG
DIGNWMDSTTGAFNYTGLVENMEMKAGAFYIGYAVPWDWLATNIKRAQDYLLQNTTLGIP
ALVQTEGLHGFLLENATIYNSPIGYACSFNRKLVEKMGRLIAQEARAIGANQLFAPLADL
ARELRYGRVEETFSEDSYLAGEMAYHYIVGMQSLNVSATVKHFVGYSLPEQGLNTAPVQG
GERYLRSTWLPSFKRAIVDAGAWSIMSAYHAYDGIPAVADWFTLTKILREEWNYDYYVIS
DSGATDRLCTAFKLCRSSPIDMEAVTTQALPAGNDVEMGGGSFNYQKIPELVESGQLDIE
VVNTAVSRVLRAKFEMGLFENPYPAAPRSEWNKLIHSLEAVELARTIDKESIVLLENHNE
TLPLKKSGSIAVIGPMAHGFMNYGDYVIYGSQWRGVTPLDGIKAAVGDAATVNYAQGCER
WSNDESGFDEAIAAAKKSDVAIVVVGTWSRDQTELWENYNATTGEHVDLDSLALVGAQGP
LIRAIRDTGIPTIVVLSSGKPITDVTWIANSTSALLQQFYPSEQGGNALADILFGDYNPS
GKLSVSFPHYVGDLPIYYDYLNSARNIGDAGHAYPNGTLEFGHQYVLGDPHAVYPFGYGK
SYSSFEYGEVRLSKTNVSATETVVVSVEVRNLDEEREATEVVQVYVVDEIASVVVPNRLL
KGFEKVVVPAGGSVEVEIEIKVKDLGLWDRKMEYVVEKGEFGVLVGSSSVDIRGRAAFWV
V

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	338	9.4e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.19e-146	8	773	2	758	beta-glucosidase BglX.
224389	BglX	5.20e-78	48	479	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	8.60e-74	1	740	1	742	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	3.75e-60	412	662	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.50e-56	49	372	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15671.1|GH3	0.0	1	781	1	781
BCS04070.1|GH3	0.0	1	781	1	781
BAX03548.1|GH3	0.0	7	775	1	770
CAK97390.1|GH3	0.0	1	781	1	804
UDD57574.1|GH3	0.0	1	780	1	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EAP_A	0.0	27	780	4	756	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	0.0	27	780	4	756	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5Z87_A	1.54e-105	20	773	26	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	5.81e-102	41	773	13	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	7.70e-100	41	773	14	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	3.11e-114	19	773	12	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	5.15e-111	38	773	35	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	6.91e-111	114	769	60	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|T2KMH9|PLH34_FORAG	1.85e-99	30	773	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	4.53e-86	117	772	35	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999770	CS pos: 21-22. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in AKAW_11018-t41_1-p1.