CAZyme Information: AKAW_10592-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_10592-t41_1-p1
• CAZy Family: GT32
• CAZyme Description: pectin lyase E

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	DF126495|CGC2	40380.14	4.0450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126495:8012-9229(-)

Full Sequence      

MRPDLPSTIMALMAFAHHSKAAQSSIVSGSAPGFAAGVTGGGDATPVYPTTIDELKEYLT
SSSPQNIVIEGTFDFVGSEGTKTYQACNIYDCTPDNGGQAILNTLGGCGDTSTYDVTIDV
AGYQGINVASDKTLVGKGTGAVLNGKGLRFVGVSNIIIQNIEITNLNPKYVWGGDALTFS
DTNQIWIDHVTTSSLGRQHYSFGQESDNAITISNSFINGKTDYSATCDGHTYWGLELVGS
SDLITFYKNYVYYTSGRSPALSGNTLFHAVNNVWADNSGHAIEGTDNGMGLFEGNWFNNV
PTIVQSGFVGQLFSSESADLSQCETYLGRDCVTNAYTSSGSFDYDDDGFFVDFENLTIAS
AASASSIESSVPSNAGNTLSST

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	116	299	5.2e-79	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.24e-45	115	301	1	190	Amb_all domain.
226384	PelB	1.01e-12	37	299	47	275	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.12e-10	126	297	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS09179.1|PL1_4	4.89e-275	10	382	1	373
BCR96677.1|PL1_4	4.89e-275	10	382	1	373
ACE00421.1|PL1_4	1.13e-261	13	382	1	370
CCD51880.1|PL1_4	5.69e-183	20	379	29	388
ATZ52739.1|PL1_4	5.69e-183	20	379	29	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.45e-113	27	376	3	355	Pectin Lyase A [Aspergillus niger]
1IDJ_A	4.73e-112	27	376	3	355	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	5.95e-105	27	376	3	356	Pectin Lyase B [Aspergillus niger]
3VMV_A	3.90e-07	118	300	66	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B3GQR3|PELE_ASPNG	2.01e-262	13	382	1	370	Probable pectin lyase E OS=Aspergillus niger OX=5061 GN=pelE PE=3 SV=1
sp|Q5BAU9|PELA_EMENI	6.14e-127	5	379	1	379	Pectin lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelA PE=1 SV=2
sp|Q2TXM4|PELA_ASPOR	6.54e-124	27	376	22	375	Probable pectin lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelA PE=3 SV=1
sp|B8N6W5|PELA_ASPFN	3.75e-122	27	376	23	371	Probable pectin lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelA PE=3 SV=1
sp|Q2UCT7|PELC_ASPOR	3.75e-122	27	376	23	371	Probable pectin lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000064

TMHMM  Annotations     

There is no transmembrane helices in AKAW_10592-t41_1-p1.