CAZyme Information: AKAW_10508-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_10508-t41_1-p1
• CAZy Family: GT31
• CAZyme Description: LPS glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644		73353.21	6.8770

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126493:65452-69784(-)

Full Sequence      

MAIEILPLTKEDIPSAVACIQKAFADDPYFHWVFNNKSGFNIHRNAASLAAHFLYGLSCN
EPIFVAKYTTNTPRDKIPTDSPVVGVCWWYSPQPPSEPVPWSVWAQDWILSFRQLYNNIR
FGGRGGLNVRRYWLWKARQQETHDRVWTDPRGYYFCNVIAVDSSMRGMGLGRKLVEVVSQ
QADREGMPCYLESSKGFPNLMIYEKLGFEMVSEIECVDGKDKCKEPMITKRRHEKAQEVC
SLRYARYFTLFNVSSHFIDHLQLAPVLSMIRGKSRFTKYIVAAFASYIILTLLFSGTGEK
YWKQDWVKIARSTLEDRALEHIQNETLGFEHIYAIGLKERTDKRDFLNLAASIAGFRVEW
VDGVHPEDMSEKALLNDNLLAPSEIGCWRAHMNALSNMVQNSYSTALILEDDADWDVSIR
QQLREFARGVRALTRNANTTKSAPYGTNWDILWVGGCASSAAPNETQFYAIPNDPTVPSV
DHRGTWGGPLDSWKEIYPETSTRFIYRADMGCCTYGYAVTKRGAERILAALAVDRLVAAV
DNSMADMCGGKDGRSQIECYAPFPNIIGTYKAAGLASKDSDIREGSDEWHEAQAWNLMYS
TRLNIHRLVAGRDTVHAQYDEGFPWSRRVLDWKEFEYPRGYLVS

Enzyme Prediction     

No EC number prediction in AKAW_10508-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	329	544	4.5e-33	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.72e-18	331	416	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	6.87e-08	328	566	1	206	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
404402	Acetyltransf_7	1.01e-06	145	209	19	82	Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.
366794	Glyco_transf_25	1.05e-05	329	544	1	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
178308	PLN02706	1.11e-04	159	208	91	139	glucosamine 6-phosphate N-acetyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38229.1|GT25	0.0	1	644	1	688
BCR98565.1|GT25	5.47e-316	227	644	1	418
BCS10899.1|GT25	1.67e-283	269	644	1	376
CAP93867.1|GT25	6.51e-161	268	641	3	382
CAP98036.1|GT25	1.44e-155	281	644	13	389

PDB Hits     

AKAW_10508-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

AKAW_10508-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AKAW_10508-t41_1-p1.