CAZyme Information: AKAW_10442-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_10442-t41_1-p1
• CAZy Family: GT31
• CAZyme Description: endo-rhamnogalacturonase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	DF126491|CGC2	52289.20	4.2492

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126491:171597-173410(-)

Full Sequence      

MRLPSLIPLSLLAGLTAGQLIGPVGPTTNLEDKTIECNILDYGGVADNQTDVAASIEATF
GECVLNNPKSRLVIPEGNYLIKRSVVLSNGTNWAFQLDGLITTAYGGNWTVDRELILQGF
AGEQIINSTINGEGDGKFLLDVLVIVNAVDFEFYSSNGLGAFQGQGYIYRNLENTDRPRL
VRLISPTNASVHDLILVDSPKFHIVFDFAVNLEAYHLTIRGANLGSYDGIDAIGTNYYIH
DSEASRNPSHHALVENLVCNQAGSGVSIGSLNVSAEISNIEARNISIIQGNNIAFIKTYP
GGSGYVRDVTFENFRSLNSLYGLDINQYWQNTWEPDTGSVTLSNLVFKNFSGSVADGALR
PPLYLFASDLTFATNVTVEEFSVWTETGTTVVNKISNIFGTGDDSYGENDGIQTLQSGES
PYTYTSTYTITASPTNWQAPSTPTWALPSTGYGTASPIPVYTPAPLWRPGGIDYNLHYWG
SF

Enzyme Prediction     

No EC number prediction in AKAW_10442-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	133	390	7.7e-40	0.7476923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	4.17e-20	160	383	61	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	6.40e-12	38	405	48	396	polygalacturonase
227721	Pgu1	9.22e-11	38	313	84	392	Polygalacturonase [Carbohydrate transport and metabolism].
177865	PLN02218	3.04e-10	38	355	69	383	polygalacturonase ADPG
215426	PLN02793	1.01e-08	188	355	187	369	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD67157.1|GH28	4.18e-304	1	482	1	455
ABD67155.1|GH28	2.41e-303	1	482	1	455
CAK96548.1|GH28	4.51e-299	1	482	1	474
QQK39531.1|GH28	3.11e-289	1	482	1	489
QRD82401.1|GH28	3.75e-278	9	482	6	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	9.13e-79	19	475	1	418	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYE5|RHGA_ASPNC	2.29e-82	6	470	6	432	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	4.54e-82	6	470	6	432	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|Q5ARE6|RHGA_EMENI	8.52e-82	15	475	14	436	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|Q00001|RHGA_ASPAC	3.28e-80	1	475	1	436	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|A1DED1|RHGB_NEOFI	3.79e-78	1	475	1	441	Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999721	CS pos: 18-19. Pr: 0.9640

TMHMM  Annotations     

There is no transmembrane helices in AKAW_10442-t41_1-p1.