CAZyme Information: AKAW_09092-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_09092-t41_1-p1
• CAZy Family: GH78
• CAZyme Description: DUF1237 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536	DF126477|CGC3	58853.71	4.9412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126477:55899-57631(+)

Full Sequence      

MRSLSLAVTLAAGLGARGAAARDEPSILRRACPDYTSYASTGHAPYSGGPLNLPYQRPAA
ECRTFVSNAVEQVIDDVTSRMVDKDMAQLFRNAFPNTLDTTIRWHVNSTSTTSSSRKMRR
DSSQWQGAQTFVVTGDINAEWLRDSTNQLTGYQTLAKKDPALYSLILGAIHTQAEFVIQS
PYCNAFQPPPPSGIQATSNGQQDTVHPAYEPSVVYECKYELDSLANFLALGNEFYENTGS
TEFLTSRWYLALDTLLNATDAQSQPTFNSNHQYVQNQYTFQRQTTLGTETLNLAGIGNPL
NSGTGLIRSALRPSDDATILGFFIPANAMMSVQLKKTADLIRAAGGDSTLASNLQTRGEN
LEQAVRQHGIFNHPKYGDVYAFEVDGYGSRIFMDDANIPSLLALPYLGFVDKTDQVYQNT
RKMILDPNGNPYYLTGSDFHGIGGPHIGLENAWPMSLLVQALTTDNVTEITDSLNLVRNS
SLLGLVHESIDVNNIKSYTRPWFAWANSVFSQTILKVAAEQPEVLFGDGAEPYVIS

Enzyme Prediction     

No EC number prediction in AKAW_09092-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	83	515	1.9e-160	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	83	515	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	5.26e-158	62	525	2	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS09358.1|GH125	0.0	1	536	1	536
BCR96870.1|GH125	0.0	1	536	1	536
CAK38960.1|GH125	0.0	1	536	1	536
QRD90853.1|GH125	5.92e-306	3	535	5	536
QMW43832.1|GH125	5.92e-306	3	535	5	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	3.17e-98	52	520	38	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.34e-95	52	520	18	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	7.45e-92	57	520	21	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.13e-77	70	514	12	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.79e-77	70	514	12	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	3.25e-181	18	525	13	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002355	0.997606	CS pos: 21-22. Pr: 0.9248

TMHMM  Annotations     

There is no transmembrane helices in AKAW_09092-t41_1-p1.