CAZyme Information: AKAW_08996-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_08996-t41_1-p1
• CAZy Family: GH75
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	DF126476|CGC3	93460.40	7.2083

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126476:187223-190152(-)

Full Sequence      

MDNAHDLSSRPLSFELESNHHSLRQLTPPIASSYSFNENDDASHSLLPAPLDNHHPSTSS
QGPPVIIQHNTYEDPHQQSESEATSQTSWQRRQKSGSGLRRYPTRRINLVQGSVLSVDYP
VPSAIRNSVEAKYRDSSDATAEEFTHLRYTAATCDPDDFNLRNGYNLRAAMFNRHTEILI
AITYYNEDKVLTSRTLHGVMQNIRDIVNLKKTQFWDKGGPAWQKIVVCLVFDGIGPCDKN
TLDVLATVGIYQDGIMKHDVDGKETVAHIFEYTTQLSVTPSQQLVRPQSDSPENLPPVQM
IFCLKQKNSKKINSHRWLFNAFGRILNPEVCILIDAGTKPGHKSLLALWEAFYNNKNLGG
ACGEIHALLGPRWEKLVNPLVAAQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRYRAI
MGRPLEQYFHGDHTLSKKLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGYKWTLSYVK
ASKGETDVPEAPPEFLSQRRRWLNGSFAASLYSVMHFNRIYKSGHNILRLLFLHVQLVYN
ICQLTMTWFSLASYWLTTSVIMDIVGTPSATNKNKGWPFGNAASPIVNNIIKALYLAFLM
QQFFLALGNRPKGSQTSYILTFLYFAVVQLYILVLSFYLVAQAFAGGNIDLDFDNGAGGF
VGSFFTSTTGLVLIALVSTYGTYIIASILYCDPWHLLTSSWAYFLGMPSTINVLNVYAFC
NWHDVSWGTKGSDDTASLPSAKTKKSETQKSFVEEVDKPQADIDIDFELTVRRALSPWQE
PMEKKEVQLEDSYKTFRTNLCEESMLDDNVDGSYGLVFQGHPMGYVGPICL

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	184	352	3.5e-71	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	3.46e-99	184	352	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	3.71e-92	180	509	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.51e-30	106	183	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	4.32e-25	301	651	115	412	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	1.33e-16	318	745	187	502	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12408.1|GT2	0.0	1	831	1	831
BCS00643.1|GT2	0.0	1	800	1	800
CAK38392.1|GT2	0.0	1	800	1	802
BCS28982.1|GT2	0.0	43	800	61	819
QKX54176.1|GT2	0.0	83	800	108	824

PDB Hits     

AKAW_08996-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92197|CHSC_ASPFU	0.0	88	800	107	822	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P30602|CHS3_EXODE	0.0	51	800	94	837	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P29070|CHS1_NEUCR	0.0	88	800	125	846	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|Q00757|CHSB_EMENI	0.0	81	800	120	845	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	0.0	81	800	116	840	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

Start	End
544	566
586	608
618	640
660	682
697	719