CAZyme Information: AKAW_08615-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_08615-t41_1-p1
• CAZy Family: GH65
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	DF126474|CGC5	67814.94	4.5698

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126474:66489-68564(-)

Full Sequence      

MSFLTTWTLVLLAIVTTALGISEDYLDDAELGVPGLDASFDYVVVGAGAGGLTLAARLAQ
HRYRVALVEAGDFYELKYPLAAVPGAGIIGIGSDVNSSTPVDWRFVAYNVPGANYRDLHY
PRGKCLGGSTGSNMMVYQRPNREAMQRWAELVDDNSYTFDRFLPFFQRTANFTPPNNDIR
HSNATAAFNLSAFDKRGEPLQVSYPDFAVPFSSWIKRGMESVGIPEIEDFNSGFLLGAQY
CALTIDPHKKIRSSSEAAFKSSPIPRLMTLALYKKTMAKRILINTERRATGVEVRTGDLI
YILRATREVIVSAGAFQSPQLLMVSGIGPASELKEHGIEVVVDLPGVGQNMWDHAFFGPA
YRVALPTSTRIATDFLYLTEVVIQYLANRTGPLTSQGIDFLAFEKVPDEVRSQFSDETIR
DLSWFPPGWPEIEYIPVALYLGDFSDPIKHQPQDGAQYASIAGALVAPTSRGNVTIISDD
TDDLPIINPNWLATKTDEEVAVAIYRRNREIFQSPGMEPIIDGEEYFPGEEFQTDSEILE
VIKDTLMTVYHASCTCKMGVRNDSMAVVDSQARVFGVDGLRVVDASAFPFLPPGHPQSVV
YMLAEKIASDIISWD

Enzyme Prediction     

No EC number prediction in AKAW_08615-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	39	612	1.5e-172	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.57e-111	39	612	5	531	choline dehydrogenase; Validated
225186	BetA	6.04e-98	37	611	5	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.34e-40	468	607	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.46e-33	35	603	51	568	Protein HOTHEAD
366272	GMC_oxred_N	7.93e-20	121	354	22	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13823.1|AA3_2	0.0	1	615	6	620
BCS02136.1|AA3_2	0.0	1	615	1	615
CAK42385.1|AA3_2	0.0	2	615	22	601
QRD89774.1|AA3_2	1.68e-254	32	614	43	627
QMW30869.1|AA3_2	1.68e-254	32	614	43	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	7.04e-57	40	615	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.93e-57	38	615	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	1.03e-52	40	611	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.42e-52	40	611	7	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.96e-52	40	611	7	569	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1U8QYA8|CICC_EMENI	3.80e-174	3	613	5	609	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.09e-169	29	611	42	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	1.24e-168	29	611	41	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	6.84e-161	37	608	38	604	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	1.45e-138	30	613	36	595	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001161	0.998799	CS pos: 20-21. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in AKAW_08615-t41_1-p1.