CAZyme Information: AKAW_08424-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_08424-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: DUF821 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442	DF126473|CGC1	50344.11	6.5045

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126473:26682-28082(+)

Full Sequence      

MQLLQNQLTSFRFIATGAVLSLILTTFLIFGAQYSNDVAKYALKTSLKPTPQTCLQTSLP
EAGNATAWEFMVERDGDNHGLSDEQCRLAFPKLFVELDKSASLREGHRITFKEVDSLQVE
DGMVRGIIHHGELYVVDFGAMPATFTRGKSTLHALHRALASFPDRGSLPDIEFVLTTEDY
SIHQGPVWSYSKRDEQGNVWLMPDFGYWSWPEVKIGPYKDIRRRIAAVDDGEVTLDGKFI
PGLPFPDKKKQLAWRGSVATNPEVRGKLLKAAQGRSWASIRVIDWDDENDVRFNLLPMED
YCQYMFLAHAEGRSFSGRGKYLLNCRSVVVSHKLVWREAHHAALIASGPEANYVEVKRDF
SDLDQKMEFLIDHPETAQRIAENSVKTFRDRYLTPAAESCYWRQLVRQYAASCEFEPVLY
TQENGRREPRGVPFESWVLTGF

Enzyme Prediction     

No EC number prediction in AKAW_08424-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	168	411	1.1e-29	0.976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	3.43e-28	125	417	40	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	8.17e-23	168	410	2	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13796.1|GT0	0.0	1	442	1	442
BCS02108.1|GT0	0.0	1	442	1	442
UDD61446.1|GT0	2.49e-249	5	439	5	436
QMW41857.1|GT0	5.90e-244	5	439	5	458
QMW29784.1|GT0	1.69e-243	5	439	5	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	7.74e-12	166	410	92	339	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	1.16e-13	163	416	133	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	1.57e-12	163	416	132	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	4.74e-11	166	410	120	367	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	3.53e-10	166	410	120	367	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|G3V9D0|PGLT1_RAT	1.48e-09	168	410	122	367	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000013

TMHMM  Annotations     

Start	End
13	35