CAZyme Information: AKAW_07932-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_07932-t41_1-p1
• CAZy Family: GH43
• CAZyme Description: FAD binding domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	DF126470|CGC1	55260.86	6.9967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126470:142547-144134(+)

Full Sequence      

MKEIVEPTDWKSDPCTLRREAPSLRQLALDSPDTLIVTPSNQFYAFIRQEYNEYNRQTEP
LAIVLPRSIDQLRQAVVYCSGHMPPIPMTIRGGGHDPYGRTVEPSAAQIDLRYFKWINIL
ESKPSSSTATEKAVAVGPGITAIEMHRALDGAGLSAATGWAGSVGVVGWSCGGGYGLSSG
AWGMGVDNILGAKVMQADGRIRDTRDDPDLLWAMRGAGQGNYGIIVELRIRVRPKPRYIA
GTLVFSLQHAVKVLSGFQALLDEGLPTNFGGEMTINTTDALGPAINLYFTWICDSHSDAH
VADGMNFKEKLLWRLQLAPLVDTVSETSTLAFHETLNQGIADSQHGYWDMASLTLARLTP
EVIGVIMRNPAPTGGASAILVHHIHGRAVQPDDTASWSHRREHYVVSPCAIAPLDASPRQ
KQVTREWTQVIYREMLQTGQALRKGYWSMSRPENCDAIDFYGIDTVKRLTKLKQKLDPSN
VFPFGLPRFNAKESQDERAHI

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	52	263	4.3e-48	0.44541484716157204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	2.17e-23	57	245	29	216	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	5.34e-23	60	205	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
183043	PRK11230	5.28e-08	57	236	53	231	glycolate oxidase subunit GlcD; Provisional
178402	PLN02805	4.71e-07	60	263	134	346	D-lactate dehydrogenase [cytochrome]
171497	PRK12436	0.001	64	232	41	194	UDP-N-acetylmuramate dehydrogenase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD62121.1|AA7	9.84e-16	26	280	8	265
QKD57322.1|GH43_11	6.05e-15	60	480	598	1041
QKD57322.1|CBM91|GH43_11	6.05e-15	60	480	598	1041
SAM83140.1|AA7	1.06e-12	39	275	62	304
BAI44126.1|AA7|CBM18	5.14e-11	29	482	245	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JQH_A	8.96e-18	31	236	20	225	Chain A, MaDA [Morus alba],6JQH_B Chain B, MaDA [Morus alba]
6FYE_A	1.72e-16	88	482	71	453	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYF_A	2.29e-16	88	482	71	453	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYB_A	2.29e-16	88	482	71	453	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]
4XLO_A	3.05e-16	88	482	71	453	Crystal Structure of EncM (crystallized with 4 mM NADPH) [Streptomyces maritimus],4XLO_B Crystal Structure of EncM (crystallized with 4 mM NADPH) [Streptomyces maritimus],4XLO_C Crystal Structure of EncM (crystallized with 4 mM NADPH) [Streptomyces maritimus],4XLO_D Crystal Structure of EncM (crystallized with 4 mM NADPH) [Streptomyces maritimus],6FOQ_A The crystal structure of EncM complexed with dioxygen under 15 bar of oxygen pressure. [Streptomyces maritimus],6FOQ_B The crystal structure of EncM complexed with dioxygen under 15 bar of oxygen pressure. [Streptomyces maritimus],6FOQ_C The crystal structure of EncM complexed with dioxygen under 15 bar of oxygen pressure. [Streptomyces maritimus],6FOQ_D The crystal structure of EncM complexed with dioxygen under 15 bar of oxygen pressure. [Streptomyces maritimus],6FOW_A The crystal structure of EncM complexed with dioxygen under 10 bar of oxygen pressure. [Streptomyces maritimus],6FOW_B The crystal structure of EncM complexed with dioxygen under 10 bar of oxygen pressure. [Streptomyces maritimus],6FOW_C The crystal structure of EncM complexed with dioxygen under 10 bar of oxygen pressure. [Streptomyces maritimus],6FOW_D The crystal structure of EncM complexed with dioxygen under 10 bar of oxygen pressure. [Streptomyces maritimus],6FP3_A The crystal structure of EncM complexed with dioxygen under 5 bar of oxygen pressure. [Streptomyces maritimus],6FP3_B The crystal structure of EncM complexed with dioxygen under 5 bar of oxygen pressure. [Streptomyces maritimus],6FP3_C The crystal structure of EncM complexed with dioxygen under 5 bar of oxygen pressure. [Streptomyces maritimus],6FP3_D The crystal structure of EncM complexed with dioxygen under 5 bar of oxygen pressure. [Streptomyces maritimus],6FY8_A The crystal structure of EncM bromide soak [Streptomyces maritimus],6FY9_A The crystal structure of EncM complex with xenon under 15 bars Xe pressure [Streptomyces maritimus],6FYA_A The crystal structure of EncM under anaerobic conditions [Streptomyces maritimus],6FYA_B The crystal structure of EncM under anaerobic conditions [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1RF55|AURO_GIBZE	2.31e-37	23	484	60	498	FAD-linked oxidoreductase aurO OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=aurO PE=1 SV=1
sp|A0A2V5HCN7|PYVE_ASPV1	2.49e-19	35	264	14	234	FAD-linked oxidoreductase pyvE OS=Aspergillus violaceofuscus (strain CBS 115571) OX=1450538 GN=pyvE PE=3 SV=1
sp|L0E2Q5|PHQH_PENFE	7.58e-17	68	234	127	300	FAD-linked oxidoreductase phqH OS=Penicillium fellutanum OX=70095 GN=phqH PE=3 SV=1
sp|A2TBU3|EASE_EPIFI	7.38e-16	60	482	128	564	FAD-linked oxidoreductase easE OS=Epichloe festucae var. lolii OX=73839 GN=easE PE=2 SV=1
sp|D4D448|EASE_TRIVH	1.30e-15	60	496	129	584	FAD-linked oxidoreductase easE OS=Trichophyton verrucosum (strain HKI 0517) OX=663202 GN=easE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000087	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AKAW_07932-t41_1-p1.