CAZyme Information: AKAW_07502-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_07502-t41_1-p1
• CAZy Family: GH33
• CAZyme Description: choline oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	DF126467|CGC1	61440.88	6.5628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126467:513629-515340(-)

Full Sequence      

MATTNEFPASDVNSYDYVIVGGGTAGCVIASRLAEYLPNKRILIIEGGPSDFMDDRVLKL
KEWLNLLGGELDYDYPTVEQPMDHPSHALFYFTGNSHIRHSRAKVLGGCSSHNTLISFRP
FEYDCKRWEQAGCTGWSFETFTRVLDNLRNTVQPVHNRHRNQLCKDWVQACSSAMNIPVI
EDFNKEIRSKGELTEGVGFFSVSYNPDDGRRSSASVAYIHPILRGEEKRPNLTILTNAWV
SRVNVDGDSVTGVDVTLQSGAKHTLRAKKETILCAGAVDTPRLMMLSGLGPREQLSGLGI
PVVKDIPGVGENLLDHPESIIIWELNRPVPPNQTTMDSDAGIFLRRELPNANGFDGRAAD
IMMHCYQIPFCLNTERLGYDTPVDAFCMTPNIPRPRSRGRIYLTSADPSVKPALDFRYFT
DPEGYDAATIVAGLKAAREVAKQSPFKDWIKREVAPGPNVQTDEELSEYGRRVAHTVYHP
AGTTKMGNLTRDPMAVVDPKLKVRGLKNVRIADAGVFPEMPTINPMLTVLAIGERAAELI
AEEAGWKREQPRL

Enzyme Prediction     

No EC number prediction in AKAW_07502-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	549	2e-93	0.5194174757281553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.40e-122	13	545	6	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.06e-115	13	540	4	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.30e-46	395	536	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.80e-33	13	533	54	569	Protein HOTHEAD
366272	GMC_oxred_N	4.64e-28	102	318	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS03844.1|AA3_2	0.0	1	553	90	631
BCS15458.1|AA3_2	0.0	1	553	1	542
CAK47101.1|AA3_2	0.0	1	553	1	542
EAA64559.1|AA3_2	0.0	1	553	1	542
BCS21375.1|AA3_2	0.0	1	553	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.91e-126	15	540	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	4.11e-126	15	540	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.16e-125	15	540	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	3.44e-56	15	544	84	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	4.97e-56	15	544	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.50e-125	15	540	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	2.32e-79	14	541	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.86e-75	15	543	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q4L9D7|BETA_STAHJ	5.84e-73	10	540	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	6.48e-73	15	540	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AKAW_07502-t41_1-p1.