CAZyme Information: AKAW_07452-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_07452-t41_1-p1
• CAZy Family: GH32
• CAZyme Description: mannosyltransferase PmtI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	DF126467|CGC2	88234.38	8.1730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126467:366249-368695(-)

Full Sequence      

MSSSPSPSLRKRGGKKESTPVPADKFSSPLSKATAPRSEWDYWLAISILTVLAFVTRFYK
ISYPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFMGWLVGYDGHFLFDNIGDS
YIEHQVPYVALRAMPAALGALTVPVVFLIMWESGYSLPACVLSAGLVLFDNAHVGEDRLI
LLDASLVLTMALSILCYVRFYKLRHEPFGRKWWKWLLLTGVSLSCVISTKYVGVFTFVTI
GSAVMVDLWNLLDIRRRGGALTMSQWGQHFVARAFALIIVPFFFYLFWFQVHFAILTRSG
PGDDFMTPEFQETLSDNVLSAQSVGIEYYDTITMKHKDTKVYLHSHLERYPLRYDDGRIS
SQGQQVTGYPYNDTNNQWQIIPTVPLDVTDTSGHKVRNGDVVQLRHMGTDTILLTHDVAS
PYYPTNQEFTTVSHEIANGDRHNDTLFEIKIENGKPGQEFRTLSSHFKLIHMPTRVAMWT
HTTPLPDWAFKQAEINGNKNILQTSNLWFVESIESLEEDSPRLVKEERQVKHLPFFRKYL
ELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPVGWWIASSL
LAVFAGVIGADQLSLRRGVDAVEEIWGQGSRSRLYNSMGFLFLCWAAHYFPFWLMGRQRF
LHHYLPAHLASALVAGALIEFIFNLEPLSVIQRVRSEDDPSGKAKASASVGRFVTAKERM
GTKSLIAGWAATLVILAGTIYGFVFYAPLTYGTPGLDVPGILARKWLGYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	49	293	4.6e-73	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	41	775	22	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	2.13e-83	47	297	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	8.24e-76	537	767	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.32e-16	335	491	4	164	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	8.09e-07	326	382	4	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS03793.1|GT39	0.0	1	775	1	775
BCS15407.1|GT39	0.0	1	775	1	775
CAK42948.1|GT39	0.0	1	775	1	771
EAA64589.1|GT39	0.0	4	775	2	773
QMW29154.1|GT39	0.0	1	775	1	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.52e-103	44	754	51	712	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	5.13e-97	23	667	45	681	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	3.17e-257	6	775	2	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	5.75e-248	44	767	60	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	3.08e-246	36	775	48	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q8BGQ4|POMT2_MOUSE	2.98e-118	42	755	127	799	Protein O-mannosyl-transferase 2 OS=Mus musculus OX=10090 GN=Pomt2 PE=1 SV=1
sp|F1Q8R9|POMT2_DANRE	5.16e-116	24	755	55	735	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000021

TMHMM  Annotations     

Start	End
42	59
86	108
129	151
179	201
221	243
270	289
586	608
634	656
725	747