CAZyme Information: AKAW_06560-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_06560-t41_1-p1
• CAZy Family: GH28
• CAZyme Description: similar to An08g04630

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		39823.01	4.0922

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126463:177908-179197(-)

Full Sequence      

MKGAAFLAFPASTLAGSVLWSGIFNSSYTVADFDEWSWSNQIAPWQWYIHGDGETSEYLA
LSSDYKNPAASDAQGLRTRLDNTSFWEGQSMQRTELIPQMSPSSSASDLGSGHLYYHFSL
SASSTNPPSSSSEHQIAFFESHFTELQYQDNTLKWNAGGDTHYSVELETGKWYNFAYDID
FDNQKVGLWASNGSDALTEVVSPVSASASSNGADFHVGVLSLTGDGTEDWFWSGVYIEKG
DLTKSIGDGSSASASGGESSSTTVAAAATTSATSSATSAVTTSVEATTAAAATPTQDVAV
ASSSTSAASTTSVATTSSSESTAAATPSASAPVIATPSAAPSAAAASGSAALPVPTTASE
ILTDVRALLTALLTRQGVHARDFTV

Enzyme Prediction     

No EC number prediction in AKAW_06560-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	18	249	5.8e-96	0.996078431372549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	3.01e-57	18	243	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR97264.1|GH131	2.62e-200	1	385	1	385
BCS09730.1|GH131	2.62e-200	1	385	1	385
CAK45436.1|GH131	1.18e-176	1	385	1	410
QMW46856.1|GH131	9.26e-117	7	252	8	257
BAE64574.1|GH131	9.26e-117	7	252	8	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LE3_A	9.07e-78	16	246	1	240	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]
3W9A_A	1.66e-73	16	252	1	237	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

AKAW_06560-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.558930	0.441053

TMHMM  Annotations     

There is no transmembrane helices in AKAW_06560-t41_1-p1.