CAZyme Information: AKAW_06244-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_06244-t41_1-p1
• CAZy Family: GH28
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863		93600.08	5.0531

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126461:756222-758813(+)

Full Sequence      

MPQEERASSHVRQLLQSLTLEEKVALLAGKNMWETVNIDRLHIPSLKMTDGPAGARGSKW
TYGSLTTWIPCGISLAATFDPAMVEQVGRVLGQEARRKGCQVLLAPTMNLSRSPLGGRNF
ESYGEDPYLVGVTATAMIRGIQAQGVGACMKHFILNDTETRRFNVDQTIDERTLREVYMK
PFTMVLDDPASVPWTAMVSYPKINGLHADISPHILPRLLRQELQFDRLVMSDWGGLNSTA
DSLRATTDLEMPGPAVRRGERLLAAIRAGEVKVAAHVDPSVRRFLQLLERTGLLGDATEA
TEHSEAATDDPIFHRIARDAAQSGLVLLKNDKAILPLKPTTLQRVAIIGPNARQPTAGGA
GSAAVNPFYVSTPEACLRDALHAANAELQVSYEQGIPSSLRPPLLGKLLTVPDGSRNGWQ
VSFFEGHALEGPVVASSMWDDSLIYLFSDGDVPAVLDDRPYSYRATGVVTPQASGRYTWS
LANTGKAKLFVDDELLIDNMEWTGLTGGFLGCSSADKTASVYLEAGRAYQLRVDNVVTLP
VVEAFDNTLFPRISGIRVGLALEQDEQEMLAQAVAAARQADVAVVVVGHNKDSEGEGGDR
ATMQLPGRTDEMVSAVCAANPNTVVVVQSASAVAMPWVDAASGLVMAWYQGQENGHALAA
ALLGDCDFSGRLPITFPRRLEDHGSNAWFPGEAAQDRNTFGEGVRVGYRHFDAQGIPALW
PFGFGLSYTQFQLTDIRVCGRVEGRFRESQPALIQARVCNVGGRDGQEVVQVYVAPSVQI
REAGEMSFPKTLAGFCKIAVPAGVSREVSIPIRGSELSWYDARVAQWRLDAGKYACWVGR
SSSQIDAELEIEVAEGDDIDMGH

Enzyme Prediction     

No EC number prediction in AKAW_06244-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	252	2.8e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	9.64e-69	30	358	47	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.37e-47	40	842	101	754	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.00e-40	40	287	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.15e-28	1	361	47	439	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.36e-27	325	728	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13433.1|GH3	0.0	1	863	1	863
BCS01725.1|GH3	0.0	1	863	37	899
CAK48047.1|GH3	0.0	1	862	1	862
QMW31943.1|GH3	0.0	9	853	7	851
QRD91011.1|GH3	0.0	9	853	9	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.65e-143	11	853	6	836	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.74e-137	11	853	6	836	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.92e-105	11	853	5	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	4.19e-102	8	853	51	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	1.60e-88	15	857	9	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	8.38e-169	11	853	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	8.25e-163	9	851	9	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	4.71e-152	11	852	6	831	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.84e-151	11	852	6	831	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	7.01e-151	11	852	6	830	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000003

TMHMM  Annotations     

There is no transmembrane helices in AKAW_06244-t41_1-p1.