CAZyme Information: AKAW_06100-t41_1-p1

Basic Information

• Species: Aspergillus luchuensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus luchuensis
• CAZyme ID: AKAW_06100-t41_1-p1
• CAZy Family: GH20
• CAZyme Description: cell wall glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		39299.85	6.6334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AluchuensisIFO4308	11755	1033177	267	11488

• Gene Location: location=DF126461:306621-307825(+)

Full Sequence      

MKRLLYLLVVLLLSYVVRALPYDDHGKKRDLGPLGDLPGGDVIVWVDQAGNALANNVVGG
GGNSNPTATADNSPATLPPLLPTLDDLDLSPAVPLPESTKNPKTGNYRRFGISYSPYNSD
GSCKTQDQVNQDLDKLAQYGFVRIYGVDCDQTNKVAKAARQRNLKVFAGVFDLQNFPSSL
DYITGAANGDWSVFHTINIGNELVNDGKNSITDVTNAVNTARNKLRAAGYQGPVVTVDTF
SVLIQHPELCQASDYCAANCHAFFDNNNTADKAGQYVKDQANKVSKAARGKKTLISESGW
PHNGQPNGKAVPSSQNQQKAIASLQQTFTGDNELVLFTAFDDLWKQDSPGTFGAEKFWGI
NQR

Enzyme Prediction     

No EC number prediction in AKAW_06100-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	118	360	2.4e-23	0.932475884244373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.85e-67	90	360	33	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13276.1|GH17	1.67e-270	1	363	1	363
BCS01560.1|GH17	1.67e-270	1	363	1	363
CAK47997.1|GH17	5.54e-244	1	362	1	362
ACQ00076.1|GH17	1.51e-131	38	360	19	361
QMW24913.1|GH17	1.75e-128	1	363	1	326

PDB Hits     

AKAW_06100-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	2.10e-69	111	360	128	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	8.79e-68	111	360	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	1.08e-64	111	360	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	6.69e-44	91	359	284	553	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	1.37e-42	109	359	308	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999780	CS pos: 19-20. Pr: 0.9827

TMHMM  Annotations     

Start	End
5	22